KEGG   Canis familiaris (dog): 488328Help
Entry
488328            CDS       T01007                                 

Gene name
GPX6
Definition
(RefSeq) glutathione peroxidase 6
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00480  Glutathione metabolism
cfa00590  Arachidonic acid metabolism
cfa04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    488328 (GPX6)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    488328 (GPX6)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    488328 (GPX6)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     488328 (GPX6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 488328
NCBI-ProteinID: NP_001243249
Position
35
AA seq 221 aa AA seqDB search
MVPQLWASALLPLLLAGLAQPTQNTQKMKVDCYNGVMGTIYEYGALTLNNEEYVQFKQYA
GKHVLFVNVATYUGLTAQYPELNALQEELKSFGVVVLGFPCNQFGKQEPGKNSEILSGLK
HVRPGGGFVPNFQLFEKGDVNGEKEQKVFTFLKNSCPPTSDLLGSSNQLFWEPMKVHDIR
WNFEKFLVGPDGVPVMRWFHQAPVSTVKADILAYLKQLKTE
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggtcccgcaactctgggcctcggctcttctcccgctgctcctggccggcctcgcgcag
cccacccaaaacacgcaaaagatgaaggtggattgctataacggggtgatgggcaccatc
tatgagtatggagccctcaccctcaacaatgaggagtacgttcagttcaagcagtatgcc
ggcaagcatgtcctctttgtcaatgtggccacctactgaggcttgacagctcagtatcct
gaactgaatgcactgcaggaggagctgaagtcttttggtgtagttgtgttgggctttccc
tgcaaccagtttggaaaacaagaaccaggaaagaactcagagattctttctgggctcaag
catgtgcgtccaggtggtggctttgtccccaattttcagctctttgagaaaggggatgtg
aatggagagaaagaacagaaggtctttaccttcctgaagaactcctgccctccaacctct
gatcttttgggctcatcaaaccagctcttctgggagcccatgaaagtccatgacatccgc
tggaattttgagaagttcctggtggggcccgatggggtccctgtcatgcgctggttccac
caggctcccgtcagcactgtcaaggcagacatcctggcctacctgaaacagctcaaaacc
gagtag

DBGET integrated database retrieval system