KEGG   Canis familiaris (dog): 488389Help
Entry
488389            CDS       T01007                                 

Gene name
G6PC2
Definition
glucose-6-phosphatase, catalytic, 2
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
cfa  Canis familiaris (dog)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    488389 (G6PC2)
   00052 Galactose metabolism
    488389 (G6PC2)
   00500 Starch and sucrose metabolism
    488389 (G6PC2)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    488389 (G6PC2)
   04151 PI3K-Akt signaling pathway
    488389 (G6PC2)
   04152 AMPK signaling pathway
    488389 (G6PC2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    488389 (G6PC2)
   04920 Adipocytokine signaling pathway
    488389 (G6PC2)
  Digestive system
   04973 Carbohydrate digestion and absorption
    488389 (G6PC2)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     488389 (G6PC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
36
AA seq 356 aa AA seqDB search
MDFLHRNGVLAIQHLQKDYRAYYNFLNFMSNVGDPRNIFSIYFPLWFQLNQTIGTKMIWV
AVIGDWFNLIFKWILFGHRPYWWVQETQIYPNHSSPCLEQFPTTCETGPGSPSGHAMGSS
CVWYVMVTAALSHTVSRMDKSLTTYLHRLTWSFLWSLFWLIQISVCISRVFIATHFPHQV
ILGVFGGMLVAEAFEHTPGIQTASLSTYLKTNLFLFLFALGFYLLLRLLDIDLLWSVPIA
KKWCANPDWIHIDTTPFAGLVRNLGVLFGLGFAINSEMFLRSCRGENGYKLSFRLLCAGA
SLMTLQLYHFIKIPTHAEHLFYVLSFCKSASIPLTVVALIPYCIHMLMKPSEKKIN
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggatttccttcataggaatggagtgctcgctattcagcatttgcagaaggactaccga
gcttactacaattttctaaattttatgtccaatgttggcgatccccggaatatcttttct
atttattttccactttggtttcaacttaatcagacaattggaaccaagatgatatgggta
gcagtcattggggactggttcaatcttatttttaaatggatattgtttggtcatcggcct
tactggtgggtccaagaaactcagatttacccaaatcactcaagtccatgccttgaacag
ttccccactacatgtgaaactggtccaggaagtccatctggccatgcaatgggctcatcg
tgtgtctggtatgtcatggtgacagctgccctgagccacactgtcagtcggatggataag
tcacttaccacttatctgcacagactgacctggtcatttctttggagtcttttttggttg
attcaaatcagtgtctgcatctccagagtattcatagcaacacattttcctcatcaagtt
attcttggagtatttggtggcatgcttgtggcagaggcctttgaacacactccaggcatc
caaacagccagcctgagcacgtatctgaagaccaacctcttcctctttctgtttgcactg
ggcttttatctgctcctcagactgcttgacattgacctgctgtggtctgtgcccatagcc
aagaaatggtgtgccaaccctgactggatccacattgacaccacaccttttgctggactc
gtgagaaatcttggggtgctctttggcttgggctttgcaatcaactcagagatgttcctt
aggagctgccgaggagaaaatggctacaagctgagtttccggctactctgtgcaggggcc
tcattgatgacgctgcagctctaccatttcatcaagatccctactcatgcagagcattta
ttttatgtcctgtctttctgtaaaagtgcatccatcccactgactgtggttgctctgatt
ccctactgtattcatatgttaatgaaaccaagtgaaaagaagattaattag

DBGET integrated database retrieval system