KEGG   Canis familiaris (dog): 488448Help
Entry
488448            CDS       T01007                                 

Gene name
GLS
Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
cfa  Canis familiaris (dog)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    488448 (GLS)
   00330 Arginine and proline metabolism
    488448 (GLS)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    488448 (GLS)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    488448 (GLS)
  Nervous system
   04724 Glutamatergic synapse
    488448 (GLS)
   04727 GABAergic synapse
    488448 (GLS)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    488448 (GLS)
   05206 MicroRNAs in cancer
    488448 (GLS)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     488448 (GLS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
37
AA seq 608 aa AA seqDB search
MMRLRGSAMLRDLLLRPPAAACAALRRPQPLAAQCRRARGGGPAAARLLPRWGGGAGAGG
GVRPAGPPARGLSGSPSEILQELGKGGPQPPQPPQPPQPPQPGASPPAAPSAPGPQDGPG
EADAFGNSEGKELVASGENKIKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRT
SDPRLKECMDMLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSH
IDELFESAKKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVPFCLQSCVKP
LKYAIAVNDLGTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVN
NAEKFDYVMQFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGI
LDFYFQLCSIEVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSG
QFAFHVGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNY
DNLRHFAKKLDPRREGGDQRHSFGPLDYESLQQELALKETVWKKVSPESNEDISTTVVYR
MESLGEKS
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgatgcggctgcggggctcggcgatgctgcgagacctgctcctgcggcctcccgccgcc
gcctgcgccgccctcaggcggccacagccgctcgccgcgcagtgccggcgtgcccggggc
gggggcccggcggccgcgcggctgctcccgcggtggggcgggggcgcgggcgcgggcggg
ggcgtccggccggcggggccccccgcgcggggcctgtcgggctccccgtcggagatcctg
caggagctgggcaagggcggcccgcagcccccgcagcccccgcagcccccgcagcccccg
cagcccggggcgtcgccgcccgccgcgccgtcggctcccggcccccaggacggccccggg
gaggcggacgcgttcggcaacagcgagggcaaggagctcgtggcctcgggcgaaaataaa
ataaaacagggtctattacctagcttggaagatttgctgttctatacaattgcagaagga
caagagaaaatacctgttcataaatttattacagcactcaaatctacaggattgcgaacg
tctgatcccaggttgaaagagtgtatggatatgttaagattaactcttcaaacaacatca
gatggtgtcatgctagacaaagatctttttaaaaaatgtgttcagagcaacattgttttg
ttgacacaagcctttagaagaaagtttgtcattcctgactttatgtcttttacctctcac
attgatgagttatttgaaagtgctaaaaagcagtctggaggaaaggttgcagattatatt
cctcagctagccaagttcagtcctgatttgtggggtgtgtctgtgtgtacagtagatgga
cagaggcattctattggagataccaaagttccattttgtcttcagtcctgtgtaaaacct
ttgaaatatgccattgctgttaatgatcttggaacagaatatgtgcatcgatatgttggg
aaagagccaagtggattaagattcaacaaactgtttttaaatgaagatgataagccacac
aatcctatggtaaatgctggagcaattgttgtgacttcattaataaagcaaggagtgaat
aatgctgaaaaatttgactatgtgatgcagtttttgaataagatggctggcaatgaatat
gttggattcagtaatgcaacgtttcagtctgaaagagaaagtggagatagaaattttgca
ataggatattacctgaaagaaaaaaagtgttttccagaaggcacagacatggttggtata
ttagacttctatttccagctatgctccattgaagtaacttgtgaatcagccagcgtgatg
gctgcaacactggctaatggtggtttctgtccaattactggtgagagagtactgagccct
gaagcagttcgaaatactctaagtttgatgcattcctgtggcatgtatgatttctcaggg
cagtttgccttccatgttggtcttcctgcaaaatctggagttgctgggggcattctttta
gttgtccccaatgtcatgggcatgatgtgctggtctcctcctctggataagatgggcaac
agtgttaagggaattcacttctgtcatgatcttgtttctctctgtaatttccataactat
gataatctgagacactttgcaaaaaaacttgatcctcgaagagaaggtggtgatcaaagg
cattcctttggaccattggactatgaaagtctccaacaagaacttgctttaaaagagaca
gtgtggaaaaaagtgtcacctgagtcaaatgaggacatctctacaactgtagtatataga
atggaaagtctgggagagaaaagctaa

DBGET integrated database retrieval system