KEGG   Canis familiaris (dog): 488467Help
Entry
488467            CDS       T01007                                 

Gene name
AOH2
Definition
aldehyde oxidase 2 (EC:1.2.3.1)
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
cfa  Canis familiaris (dog)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    488467 (AOH2)
   00350 Tyrosine metabolism
    488467 (AOH2)
   00380 Tryptophan metabolism
    488467 (AOH2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    488467 (AOH2)
   00760 Nicotinate and nicotinamide metabolism
    488467 (AOH2)
   00830 Retinol metabolism
    488467 (AOH2)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    488467 (AOH2)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     488467 (AOH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
37
AA seq 1335 aa AA seqDB search
MASVPNSDELIFFVNGRKVTEKNADPEVNLLYYLRKVLCLTGTKYSCGGGGCGACTVMVS
RYNPKTKKIHHYPVTACLVPICSLYGAAVTTVEGVGSINTRIHPVQERLAKCHGTQCGFC
SPGMVMSIYTLLRNHPEPTPEQITKALGGNLCRCTGYRTIVESGKTFCRESTVCGMKSSG
KCCMDQEERSFVNRQEKICTKLYNEDEFQPLDPSQEPIFPPELIRMAEDPNKRRLTFQGE
RTTWIAPVTLNDLLELKANFPEATLIMGNTTVGPSIKFRDEFHPVFISPLGLPELYFVDC
TDDGVTIGAGYSLAQLNDALHLIVLEQPKEKTKTYSALLKHLRTLAGAQIRNMATLGGHV
VSRPNFSDLNPILAAGNATINLLSKEGKRQIPLNSHFLERSPEASLKSEEIVLSVYIPYS
TQWHFVSGLRLAQRQENAFAIVNAGMSVKFEDGTDTIKNLQMFYGSVDSTVVSASQTCQQ
LIGRQWDDQMLSDACRLVLDEIDIPPAAGGGMVEYRRTLIISLLFKFYLKVRRGLNKMDP
QKFPDIPEKFMSALEDFPIKTPQGTQMFQCVDPYQPPQDPIGHPVMHQSAIKHATGEAVF
SDDTPPIARELFLAVVTSTKAHAKIISFDASEALALPGVVDVITAEDVPGSNNHRGEILY
AQNEVICVGQIICTVAADIYAHAREAAKKVKITYEDIEPRIITIEQALEHNSFFTTEKKI
EQGNVEQAFKYVDQIIEGEAHVEGQEHFYMETQTILAIPKEEDKEMVLYVGTQFPSHVQE
FVAATLNIPRSRIACHMKRTGGGFGGKVTKPAVLGAVGAVAANKTGRPIRFILERGDDML
ITGGRHPLLGKYKIGFMNNGVIKAADVEYYINSGCTPDESESVIDFVVLKSENAYHIPNF
RCRGRACKTNLPSNTAFRGFGFPQATVVVEAYITAVASQCNLPPEEVKEINMYKRISKTA
YKQTFNPEPLRKCWKQCLEKSSFYPRKLAAEEFNKKNYWKKRGLAVVPMKFTIGFPVAYY
NQAAALVHIYLDGSVLVTHGGCEMGQGLHTKMIQVASRELNIPQSYIHLSETSTVTVPNA
SFTAASMGADINGKAVQNACQILMARLQPVIRKNPKGKWEDWIAKAFEQSISLSTTGYFK
GYLTNMDWEKEKGEPYPYFVYGASCSEVEVDCLTGAHKLLRTDIYMDAAFSINPALDIGQ
VQGAFIQGMGFYTIEELKYSPEGVLYSRSPDDYKIPTVTEIPEEIRVTLVHSRNPIAIYS
SKGLGESGMFLGSSVLFAIYDAVTAARKERGLTKTFSLNSPATPEWIRMTCVDQFTDMIP
RDDPSTFTPWSIRVS
NT seq 4008 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgttcccaattctgatgaactgattttttttgtgaatggaagaaaggtcaca
gagaagaatgctgatcctgaagtaaacctactgtactacctgaggaaagtcctctgtctc
acaggcaccaagtatagctgtgggggaggaggctgcggcgcctgtactgttatggtatca
agatacaaccccaagaccaagaagatccaccactatccagtgacagcatgcttggtgccc
atctgctctctgtatggagctgctgtcacaacagtggaaggtgtaggaagcatcaacacc
aggattcatcccgtgcaggaaagactggccaagtgtcatggcacacagtgtggcttctgt
agcccagggatggtgatgtccatctacacactgctgagaaaccacccagagccaaccccg
gagcagataaccaaagcccttggaggtaacttgtgccgctgtactggataccgaacaatt
gtagaaagtggaaaaactttctgtagggaatcaactgtttgtggaatgaaaagttcagga
aaatgttgcatggatcaagaagagaggtcttttgtaaatagacaggaaaaaatatgtacc
aaactgtataatgaagatgaattccagcccttggatccatcccaggaacctatattccct
cctgaactaataagaatggcagaagatccaaacaagagaagactgaccttccaaggggag
aggactacctggattgcccctgtgaccctcaacgaccttctggaactgaaagccaatttc
cctgaagccaccctcataatgggaaacactacagtgggacccagcattaaattcagagat
gaattccatccagttttcatatctccacttgggcttccagaactatattttgtggactgc
acagatgatggggtgacaataggtgcgggatacagcctggcccagttgaatgatgcctta
catcttattgttttggagcaaccaaaggagaagactaagacttacagtgctctcctgaag
catctgaggacacttgccggagcccagataaggaatatggcgactttaggaggacatgtg
gtgagcagacctaatttttctgacctaaatcccattttagcagcaggaaatgctactatc
aatctgctatctaaagaaggaaaacggcagattcctttgaacagccatttcctggagaga
tcccctgaagccagccttaaatcggaagagattgtgttatctgtttatattccctactct
actcagtggcactttgtgtcaggactccggctggcccaacgtcaggagaatgcctttgcc
attgtcaatgctggcatgagtgtgaagtttgaagatggtacagacacaatcaagaacctt
caaatgttctacggaagtgttgactccactgttgtctctgcaagccaaacgtgccagcag
ctcatcggaaggcaatgggatgaccaaatgctgagcgatgcctgccgattggtcctggat
gagattgacattccgccagccgctgggggcggcatggtagagtacaggcgaaccctcatc
atcagcttactcttcaaattctacctcaaagtgaggcgaggactgaataaaatggatccc
cagaagtttcctgatatcccagaaaagttcatgagtgctctagaagatttccccataaaa
acaccccaaggaactcagatgttccagtgtgtggatccctaccaacccccacaagacccc
atcggccacccagtcatgcaccagtcagccatcaaacatgccacaggggaagctgtattt
agtgatgacacgcccccaattgcccgagaactcttcctggctgtagtcaccagcaccaaa
gctcatgcaaagatcatatcctttgatgcttcagaagccctggcccttccaggtgttgtt
gatgtgataacagcagaggatgtgccaggaagtaataaccatcgcggagagattctctat
gcgcagaatgaggtgatctgcgtgggtcagattatctgcactgtggctgctgacatctat
gctcatgcacgagaggcggctaaaaaagtgaagatcacttatgaagacatagaaccaagg
attatcacaatagagcaagccctagagcacaattcattttttaccactgaaaaaaaaatc
gagcaaggaaatgtagagcaagcctttaaatatgttgatcaaatcattgaaggtgaggcc
cacgtagaagggcaggaacatttttacatggaaacacaaactatcctggctatcccaaaa
gaagaagataaagaaatggtattgtacgttgggacacagtttccaagccatgtgcaggaa
tttgtggctgcaacattaaacatcccaaggagtcgaatcgcctgccacatgaaaagaact
ggaggagggtttgggggaaaagtaaccaagcccgctgtgctaggagctgtcggtgccgtg
gccgccaataagactggccgcccaatccggtttattctggagcgtggtgatgacatgctg
ataactggtggccgccacccactccttggaaaatacaaaattggattcatgaacaatggt
gtgatcaaagctgctgatgttgaatattatatcaacagtggatgtactcctgatgagtct
gagtcggtgatagacttcgtcgtgttgaaatctgaaaatgcatatcatattcctaatttc
cggtgccggggtagagcttgcaaaacaaatttgccatccaacactgccttccgcggattt
ggcttccctcaggctacagtggtagtagaagcttacataactgctgtggcatctcagtgt
aatttaccccctgaagaggttaaagaaataaacatgtataagagaatcagcaaaacagcc
tacaagcagacatttaatccggagcccttgcgaaaatgctggaaacaatgtctggaaaaa
tcttcattctatcctaggaaactggctgcggaggaatttaacaaaaagaactactggaag
aagaggggccttgccgtggtccccatgaaatttactattgggttccccgtggcctactac
aatcaggcggccgctctagtccacatctacctcgatggctctgtcctggtgactcatgga
ggctgtgaaatgggacaaggccttcacaccaaaatgattcaggtggctagtcgagaactg
aacatcccccagtcgtacatacacctgtctgagacaagcaccgtcacggtgcccaacgct
tccttcacggcggcgtcaatgggagcagacatcaacgggaaggctgtacagaatgcctgc
caaattctcatggcccgtcttcagccagtcatcaggaaaaaccctaaaggaaaatgggag
gactggattgcaaaagccttcgaacaaagcatcagtctctcaactactggatatttcaaa
ggctacctgacaaatatggactgggagaaggagaaaggtgaaccctatccatattttgtt
tatggagcatcctgttctgaggttgaagtcgactgtctgactggggctcataagcttctt
cggactgacatctacatggatgctgctttcagcataaacccagccctggacattggacag
gtacaaggagcattcatccaaggcatgggattctataccatagaggaactgaaatattcc
ccagaaggcgtgctttattctcgaagtccagatgactacaaaatccctactgtcactgag
ataccagaagagatccgtgtcactttggtgcattcccgaaatcccatagccatctactca
tccaagggattgggtgaatctggaatgttcttgggatcctctgtgttgttcgccatatat
gatgcagtgactgctgcccgtaaagaaagggggctgaccaagaccttctccctgaatagc
ccagcaactcctgagtggattaggatgacttgtgtggatcagtttactgacatgattcct
agagatgatccttcaacatttacaccttggtctatccgtgtgtcttga

DBGET integrated database retrieval system