KEGG   Canis familiaris (dog): 488774Help
Entry
488774            CDS       T01007                                 

Gene name
RASGRF1
Definition
Ras protein-specific guanine nucleotide-releasing factor 1
Orthology
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
cfa  Canis familiaris (dog)
Pathway
MAPK signaling pathway
Ras signaling pathway
Focal adhesion
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    488774 (RASGRF1)
   04010 MAPK signaling pathway
    488774 (RASGRF1)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    488774 (RASGRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 1299 aa AA seqDB search
MQKGIRLNDGHVASLGLLARKDGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSS
RPSGLYLLEGCVCDRAPSPKPALSAKEPLEKQHYFTVNFSHENQKALELRTEDAKDCDEW
VAAIAHASYRTLATEHEALMQKYLHLLQIVETEKTVAKQLRRQIEDGEIEIERLKAEIAS
LLKDNERIQSTQTVTPNDEDSDIKKIKKVQSFLRGWLCRRKWKTIIQDYIRSPHADSMRK
RNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
QIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLL
KHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS
RIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLG
SLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLEEPESTEEDAKGSS
QDIDHLDFKIGVEPKDSPPFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENS
KVTVPQMIKSDASLYCDDVDIRFSKTMNSCKVLQIRYASVGRLLERLTDLRFLSIDFLNT
FLHSYRVFTTAVVVLDKLITIYRKPISAIPASSGQASRGPVGHREPWAPARSLELLFASG
QNNKLLYGDPPKSPRATRKFSSPPPLSITKTSSPSRRRKLSLNIPIITGGKALDLAALSC
SSNGYTSLYSAVSPFSKATLDTSKLFVSSSFANKIPDEGETATEKPEEPVALSKQSSEVS
VREESDNDQTQSDDGDTEASPTKSPTTPKSVKSKNSSEFPLFSYNNGVVMTSCRELDNTR
SALSAASAFAIATAGANEGTPNKEKYRRMSLASTGFPPDQRNGDKEFVIRRAATNRVLNV
LRHWVSKHSQDFETNDELRCKVISFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQI
TLEEITQMAEGVKAEPFENHSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKVEKNERTP
YIMKTTKHFNDISNLIASEIIRNEDINARVSAIEKWVAVADICRCLHNYNAVLEITSSMN
RSAIFRLKKTWLKVSKQTKALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDL
AFIEEGTPNYTEDGLVNFSKMRMISHIIREIRQFQQTAYKIEHQVKVSRQCSDPWALTQE
GVDTTGAPQVRPAPGGGEGPPEDGHREQQQTGPKQVTIG
NT seq 3900 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaggggatccggctgaacgatggccacgtcgcgtccctggggctgctggcgcgc
aaggacggcacgcgcaaaggctacctgagcaagcggagttcggacaacacaaaatggcaa
accaagtggttcgcgctgctgcagaacctgctcttctacttcgagagcgactcgagctcg
cggccctcggggctctacctgctggagggctgcgtctgcgaccgcgcgccctcccccaag
cctgcgctctcggccaaggagccgctggagaaacagcattatttcacggttaacttcagc
catgagaaccagaaagccctggagctgaggacagaggatgccaaggactgtgacgagtgg
gtggcagccatcgctcatgccagctaccggaccctggccacagagcacgaagcgctgatg
caaaagtatctgcacctcctgcagatcgtggagacagagaagacagtggccaaacagctg
cggcggcagatcgaggatggggagatcgagatcgagcggctgaaggcagagattgcatca
ctgctcaaggacaatgagcgcatccagtccacgcagaccgtcacccccaacgatgaagac
agtgacatcaagaagattaagaaggtgcagagcttcctgcggggctggctgtgccggcgc
aagtggaagaccatcatccaggactacatccgctcgccgcacgctgatagcatgcggaag
aggaaccaggtggtgttcagcatgctggaggccgaggccgagtatgtgcagcagctccac
atcctggttaacaacttcctgcgcccactgcggatggccgccagctccaagaagcccccc
atcacgcacgacgacgtcagcagcatcttcctcaacagcgagaccatcatgttcctgcac
cagatcttctaccaaggcctgaaggcccgcatctccagctggcccaccctggtcctggct
gacctgttcgacatcctgctgccgatgctcaacatctaccaggagttcgtccgcaaccac
cagtacagcctgcagatcctggcgcactgcaagcagaaccgggacttcgacaagctgctg
aagcactatgaggccaagcccgactgcgaggaacggaccctggagaccttcctcacctac
cccatgtttcagatccccaggtacatcctgacgctgcatgagctcctggcgcacacccct
cacgagcacgtggagcgcaacagcctggactatgccaagtccaaactggaggagctgtcc
aggataatgcatgacgaagtgagtgagacagagaacatccggaaaaacctcgccatcgag
cgcatgatcattgaaggctgcgagatcctgctggacaccagccagacttttgtgagacaa
ggctcgctcatccaggtgcccatgtctgagaagggcaagatcaccaggggacgcctgggg
tctctgtccctaaagaaagagggtgagcggcagtgcttcctgttctccaagcacctgatt
atctgcaccagaggctctggtgggaaactccacctgaccaagaacggggtcatctccctc
atcgactgcaccttgctggaggagccggagagcacagaggaagacgccaaaggatccagc
caagacatagaccacttggattttaagatcggggtggagcccaaagactccccgcctttc
acggtcatcctcgtggcctcgtccagacaggagaaggcagcgtggaccagtgacatcagc
cagtgtgtggataacatccggtgcaatgggctcatgatgaacgcctttgaggagaactcc
aaggtcactgtgccacagatgatcaaatccgacgcctccttgtactgcgatgacgtagac
attcgcttcagcaagaccatgaactcgtgcaaagtgctgcagatccggtacgccagcgtg
gggcggctgctggaacggctcacggacctgcgcttcctgagcatcgacttcctcaacacg
ttcctgcactcgtaccgcgtcttcaccacggccgtcgtggtcctggacaagctcatcacc
atctacaggaagcccatcagcgccatccccgccagctctggccaagcctcgaggggcccg
gtgggtcaccgtgagccctgggcccctgccagatcactagagctcttattcgccagcggc
cagaacaacaagcttctgtatggtgaccctcccaagtccccgcgcgccacgcgcaagttc
tcctcaccgccacccctgtccatcaccaagacgtcatcccccagccgccggcggaagctg
tcgctgaacatccccatcatcacgggcggcaaggccctggacctggccgccctcagctgc
agctccaacggctacaccagcctgtactcggccgtgtcccccttcagcaaggccacgctg
gacaccagcaagctcttcgtatccagcagctttgccaacaagattccagacgaaggtgaa
acggccactgagaagcccgaagagcccgtggctctcagcaagcagagctcagaagtctcc
gtgagggaagagtccgataacgatcaaacccagagtgacgacggggacactgaggcgtcc
ccaaccaaatcgccaacaacgccaaagtcagtcaaaagcaaaaattcctcagagttcccc
ctcttctcctacaacaacggggtggtcatgacctcgtgtcgggagctggacaacacacgc
agcgccctgtccgcggcctctgcctttgccatagccacggcgggagccaacgagggcacc
ccgaacaaagagaagtaccggaggatgtccctggccagcacagggtttccccctgaccag
aggaacggggacaaggagttcgtgatccgcagagcggccaccaaccgcgtcctgaacgtg
ctccgccactgggtctccaaacactcgcaggactttgagaccaatgacgagctgcgatgc
aaggtgatcagcttcctggaggaggtcatgcacgacccagagctgctgacccaggagagg
aaggctgcggccaacattatcaggactctgacccaggaggacccaggggacaaccagatc
acactggaggagatcacgcagatggccgaaggcgtgaaggcagagccctttgaaaaccac
tcggccctggagatagcggagcagctgaccctgctggaccacctggtcttcaagaagatc
ccttacgaggagttcttcgggcaaggctggatgaaagtggagaagaacgagcggacgccc
tacatcatgaaaaccaccaagcatttcaatgacatcagtaacttgattgcttcagaaatc
atccgcaatgaagacatcaatgcaagagtgagcgccatcgagaagtgggtggctgtggct
gacatatgccgctgcttacacaactataacgctgtgctggaaatcacctcgtccatgaac
cggagcgcaatattccggctgaaaaagacgtggctcaaagtctctaagcagacaaaagct
ttgattgataagctccaaaagcttgtatcatcagagggcagatttaagaatctgagagaa
gctctgaaaaattgtgatccaccctgtgtcccttacctggggatgtacctcaccgacctg
gccttcatcgaggaggggacacccaattacacggaggatggcctggtcaacttctccaag
atgagaatgatatctcatattatccgagagatccgccagtttcaacaaactgcgtataaa
atagaacaccaagtgaaggtaagccgccagtgctccgacccttgggctctcacacaggag
ggtgtggacaccacgggggccccgcaggtgagaccggctccaggaggtggggagggccca
cctgaggatggccacagggagcagcagcagacaggccccaagcaggtgaccatcggctag

DBGET integrated database retrieval system