KEGG   Canis familiaris (dog): 489030Help
Entry
489030            CDS       T01007                                 

Gene name
PRF1
Definition
(RefSeq) perforin 1 (pore forming protein)
  KO
K07818  
perforin 1
Organism
cfa  Canis familiaris (dog)
Pathway
Apoptosis
Natural killer cell mediated cytotoxicity
Type I diabetes mellitus
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    489030 (PRF1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    489030 (PRF1)
 Human Diseases
  Immune diseases
   05320 Autoimmune thyroid disease
    489030 (PRF1)
   05330 Allograft rejection
    489030 (PRF1)
   05332 Graft-versus-host disease
    489030 (PRF1)
  Cardiovascular diseases
   05416 Viral myocarditis
    489030 (PRF1)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    489030 (PRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 555 aa AA seqDB search
MGARLFLPGLVLLLLPTPTPAPCHTATRNECRRNRWFVPGSMLAGEGMDVTSLKRSGSFP
VDTESFLRPDGTCTLCRNTLRGGALQRLPLALTDWRAQGSGCQRRVVKAKASSTEGVARE
AASNIHNDWRVGLDVSPKPNINVHVSMAGSHSRVADFAAQKTHQDRYSFSTDVVECRFYS
FHLVHSPPLHPNFQRALSDLPPNFNTSTEADYLRLISNYGTHFIRSMELGGRTLALTALR
TCELALEGLTADEVSDCLTVEAQVSISDHANPSSEFKACEEKKKKHKMTTSFHQAYQERF
SEIIGGHHTSMSDLLFGNQAGPEQFSAWMASLLDRPGLVDYTLEPLHVLLESQDPRREAL
RQAVSKYVMDRARWKNCSRPCPPGQQKSPHNPCHCVCHNSGITNQDCCPRQRGLAHLEVM
NFQAMGLWGDYFTATDAYLKVFFGGQEQRTYTVWNNNNPTWVTRLDFGNVLLSTGGPLRV
QVWDQDYGWDDDLLGTCDQKAQSGSHEVRCNLSHGHLRFSYIAKCLPHLTGATCLEYAPH
GRLGEPPGNRSGPVW
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcccgcctgttcctcccgggcctcgtcctgctgctgctgcccacgcccacccca
gccccctgccacacggccacgcgcaacgagtgccggcgcaaccgctggttcgtgcctggc
tcgatgctggccggggagggcatggacgtgaccagcctcaagcgctcgggctccttccca
gtcgacacagagagcttcctgcggcccgacggcacctgcaccctctgccgcaacacccta
cgggggggtgccctccagcgcctgcccctggcactgaccgactggcgcgcccagggctcg
ggctgccagcgccgcgtggtcaaggccaaggccagctccaccgagggtgtggccagggaa
gcagccagcaacatccacaacgactggcgcgtggggctggatgtgtctcccaagcccaac
atcaatgtgcatgtgagcatggccggctcgcactccagggtggccgacttcgctgcccag
aagacccaccaggacaggtacagcttcagcactgacgtggtggagtgtcgcttctacagt
ttccacctggtacactctccgccactgcaccccaatttccagagggccctcagcgacctg
ccccccaatttcaacacctccacagaggctgactacctcaggctcatctccaactatggc
acccacttcatccggtccatggagctgggcggccggaccctggccctcactgccctgcgt
acgtgtgagctggccctggaagggctcacagccgatgaggtgtcagactgcctaacagtc
gaggcccaggtcagcataagtgaccacgccaacccttcatcagaattcaaggcctgtgag
gaaaagaagaagaagcacaagatgacaacctccttccaccaggcctaccaggaacgcttt
tccgagataattggtggccaccatacctccatgagtgacctgctgtttgggaaccaggcc
gggccggagcagttctcagcctggatggcctcactgctggacagacccggcctggtggac
tacaccctggagcctctgcatgtgctcctggagagccaggacccacggcgggaggcgctg
aggcaggctgtgagcaagtacgtgatggacagagcccgttggaagaactgcagcaggccc
tgccccccggggcagcagaagagcccccacaacccatgccactgtgtgtgccacaactcg
gggatcaccaaccaggactgctgtccccggcagaggggcctggcccacttagaggttatg
aacttccaggcaatgggcctgtggggagactacttcacggccacagatgcctatctgaaa
gtcttctttggaggccaggagcagagaacctacacggtgtggaacaataataaccccacg
tgggtgacgcggctggacttcgggaacgtgctcctgtccacgggggggcccctgagggtt
caggtctgggaccaagactatggctgggatgatgacctccttggcacctgtgaccagaaa
gcacagtctggctcacatgaggtcaggtgcaacctgtcccacggtcacctgagattctcc
tacattgccaagtgcttgcctcacctgacgggggcaacctgcctggagtatgccccccat
ggtcgtctgggagagcctccaggaaaccggagtgggccagtgtggtga

DBGET integrated database retrieval system