KEGG   Canis familiaris (dog): 489091Help
Entry
489091            CDS       T01007                                 

Gene name
PFN3
Definition
(RefSeq) profilin 3
  KO
K05759  profilin
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04015  Rap1 signaling pathway
cfa04810  Regulation of actin cytoskeleton
cfa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    489091 (PFN3)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    489091 (PFN3)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    489091 (PFN3)
Membrane trafficking [BR:cfa04131]
 Others
  Actin-binding proteins
   Others
    489091 (PFN3)
Cytoskeleton proteins [BR:cfa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     489091 (PFN3)
Exosome [BR:cfa04147]
 Exosomal proteins
  Proteins found in most exosomes
   489091 (PFN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Profilin
Motif
Other DBs
NCBI-GeneID: 489091
NCBI-ProteinID: XP_013968463
Ensembl: ENSCAFG00000016400
UniProt: E2QV64
Position
4
AA seq 137 aa AA seqDB search
MGDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRRTFL
QAGLSIAGRRCCVLRDHLLSEGDGVLDARTKGLDGRAICVGHTPRVLLVLMGRRGAHGGI
LNKTAHELINGLRTQGT
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgggagactggaaaggctatatcagcgcagtgctccgggaccagcgtattgacgacgtg
gccatcgtgggccactcggacaatcgctgcgtgtgggcatcacgccctggcggccttctg
gctgccatatccccgcaggaggtgggtgtgctcacagggcccgaccgccgcactttcctg
caggcaggtctgagcattgcaggccgccgctgctgcgtcctccgtgaccacttgctgtct
gagggcgatggcgttctggacgcacgcactaaggggctggatgggcgcgccatctgcgta
ggccacaccccgcgcgtgctccttgtgcttatgggccgtcgtggcgcgcacggcggcatc
ctcaataagacagcgcatgaactgatcaacgggctccgcacgcagggcacctag

DBGET integrated database retrieval system