KEGG   Canis familiaris (dog): 489392Help
Entry
489392            CDS       T01007                                 

Gene name
APOA4
Definition
apolipoprotein A-IV
Orthology
K08760  
apolipoprotein A-IV
Organism
cfa  Canis familiaris (dog)
Pathway
Fat digestion and absorption
Vitamin digestion and absorption
Class
Organismal Systems; Digestive system; Fat digestion and absorption [PATH:cfa04975]
Organismal Systems; Digestive system; Vitamin digestion and absorption [PATH:cfa04977]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 384 aa AA seqDB search
MFLKAVVLTLSLVAITGARAEVSADQVATVVWDYFSQLSNNAKEAVEHLQQSELTQQLNA
LFQDKMGQVNTYTDNLQKKLVPFATELHERLSKDSEKLKEEIRKELEELRARLLPHASEV
SQKIGDNMRELQQRFGPYAEELRTQVNTHAEQLRNQLTSHAQRMQSALRQNVDDLHSSLT
PFADELKAKIDQNVEELKGHLTPYTDELKVKIDQNVEELRRSLAPYAQDVQEKLNHQLEG
LAFQMKKNAEELKAKISANAEELRQRLAPVAEDVRGKLKDNTAGLHKSLAELSSRLDQQV
EEFRRNVGPYGETFNKALLQQVEELRQKLGPYAGDMEDHLSFLEKDLRDKVNSFFSTLQE
KESQDTPVALPKQEQEQSAVPLES
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgaaggctgtggttctgaccctgtccctggtggccatcaccggtgcccgggct
gaggtcagtgccgaccaggtggccactgtagtgtgggactacttcagtcagctgagcaac
aatgccaaggaagctgtggaacatctccagcagtctgagctcacccagcagctcaatgcc
ctcttccaggacaagatggggcaagtgaacacctacaccgataacctgcagaagaagctc
gtgccctttgccacggagctgcacgaacgcctgagcaaagactcggagaagctgaaggaa
gagattcggaaggaactggaggagctgcgggcccggctgctgccccacgccagcgaggtg
agccagaagatcggggacaacatgcgcgagctgcagcagcgcttcgggccgtacgcggag
gagctgcgcacccaggtcaacacccacgcggagcagctgcgcaaccaactgacatcgcac
gcgcagcgcatgcagagcgcgctgcgccagaacgtggacgacctgcactcctccctgacc
cccttcgccgatgagctaaaggccaagatcgaccagaacgtggaggagctcaaggggcac
ctcactccctacaccgacgagctcaaggtcaagatcgaccagaacgtggaggagctgcgc
cgcagcctggcgccctacgcgcaggatgtccaggagaagctcaaccaccagctcgagggg
ctggccttccagatgaagaagaacgccgaggagctcaaggccaagatctcagccaacgcc
gaagagctgcggcagaggctggcgcccgtggctgaggacgtgcgtggcaagctgaaggac
aacaccgcggggctgcacaagtctctggccgagctgagcagccgcctggaccagcaggtg
gaggagttccgccgcaacgtggggccctacggcgagaccttcaacaaagccctgctgcag
caggtggaggagcttaggcagaagctgggcccctatgcgggggatatggaagaccacctg
agcttcctggagaaggatctgagggacaaggtcaactcttttttcagcaccctccaggag
aaagagagccaggacacgcctgtggccctccccaagcaggagcaggagcagagcgccgtc
cctttagagagctga

DBGET integrated database retrieval system