KEGG   Canis familiaris (dog): 489392Help
Entry
489392            CDS       T01007                                 

Gene name
APOA4
Definition
(RefSeq) apolipoprotein A4
  KO
K08760  apolipoprotein A-IV
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04975  Fat digestion and absorption
cfa04977  Vitamin digestion and absorption
cfa04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    489392 (APOA4)
   04979 Cholesterol metabolism
    489392 (APOA4)
   04977 Vitamin digestion and absorption
    489392 (APOA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Apolipoprotein Baculo_PEP_C ApoLp-III YtxH DUF883 Gp58 ApoO FliT KapB Prominin DUF445 DUF1845 DUF1664 CorA Bacillus_HBL DUF1640 DUF2884 Phasin ApoA-II Fzo_mitofusin BshC Apo-CIII SF-assemblin Phage_Mu_Gam Fib_alpha WXG100 Endotoxin_N Flg_hook His_Phos_1 DivIVA ApoC-I DUF1690 LMP DUF4419 FUSC MbeB_N
Motif
Other DBs
NCBI-GeneID: 489392
NCBI-ProteinID: XP_546510
Position
5
AA seq 384 aa AA seqDB search
MFLKAVVLTLSLVAITGARAEVSADQVATVVWDYFSQLSNNAKEAVEHLQQSELTQQLNA
LFQDKMGQVNTYTDNLQKKLVPFATELHERLSKDSEKLKEEIRKELEELRARLLPHASEV
SQKIGDNMRELQQRFGPYAEELRTQVNTHAEQLRNQLTSHAQRMQSALRQNVDDLHSSLT
PFADELKAKIDQNVEELKGHLTPYTDELKVKIDQNVEELRRSLAPYAQDVQEKLNHQLEG
LAFQMKKNAEELKAKISANAEELRQRLAPVAEDVRGKLKDNTAGLHKSLAELSSRLDQQV
EEFRRNVGPYGETFNKALLQQVEELRQKLGPYAGDMEDHLSFLEKDLRDKVNSFFSTLQE
KESQDTPVALPKQEQEQSAVPLES
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgaaggctgtggttctgaccctgtccctggtggccatcaccggtgcccgggct
gaggtcagtgccgaccaggtggccactgtagtgtgggactacttcagtcagctgagcaac
aatgccaaggaagctgtggaacatctccagcagtctgagctcacccagcagctcaatgcc
ctcttccaggacaagatggggcaagtgaacacctacaccgataacctgcagaagaagctc
gtgccctttgccacggagctgcacgaacgcctgagcaaagactcggagaagctgaaggaa
gagattcggaaggaactggaggagctgcgggcccggctgctgccccacgccagcgaggtg
agccagaagatcggggacaacatgcgcgagctgcagcagcgcttcgggccgtacgcggag
gagctgcgcacccaggtcaacacccacgcggagcagctgcgcaaccaactgacatcgcac
gcgcagcgcatgcagagcgcgctgcgccagaacgtggacgacctgcactcctccctgacc
cccttcgccgatgagctaaaggccaagatcgaccagaacgtggaggagctcaaggggcac
ctcactccctacaccgacgagctcaaggtcaagatcgaccagaacgtggaggagctgcgc
cgcagcctggcgccctacgcgcaggatgtccaggagaagctcaaccaccagctcgagggg
ctggccttccagatgaagaagaacgccgaggagctcaaggccaagatctcagccaacgcc
gaagagctgcggcagaggctggcgcccgtggctgaggacgtgcgtggcaagctgaaggac
aacaccgcggggctgcacaagtctctggccgagctgagcagccgcctggaccagcaggtg
gaggagttccgccgcaacgtggggccctacggcgagaccttcaacaaagccctgctgcag
caggtggaggagcttaggcagaagctgggcccctatgcgggggatatggaagaccacctg
agcttcctggagaaggatctgagggacaaggtcaactcttttttcagcaccctccaggag
aaagagagccaggacacgcctgtggccctccccaagcaggagcaggagcagagcgccgtc
cctttagagagctga

DBGET integrated database retrieval system