KEGG   Canis familiaris (dog): 489400Help
Entry
489400            CDS       T01007                                 

Gene name
USP28
Definition
ubiquitin specific peptidase 28
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
cfa  Canis familiaris (dog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 1122 aa AA seqDB search
MLLNQLREITGIQDPSFLHEALKASNGDITQAVSLLTEERVKEPSQDTVATEPSEVEGSA
ANKEVLAKVIDLTHDNKDDLQAAIALSLLESPKIQADGRDLNRMHEAASAETKRSKRKRC
EVWGENPNPNDWRRVDGWPVGLKNIGNTCWFSAVIQSLFQLPEFRRLVLSYSLPQNVLEN
CPSHTEKRNIVFMQELQYLFALMMGSNRKFVDPSAALDLLKGAFRSPEEQQQDVSEFTHK
LLDWLEDAFQLAVNVHSNPRNKSENPMVQLFYGTFLTEGVREGKPFCNNETFGQYPLQVN
GYRNLDECLEGAMVEGDIELLPSDHSVTYGQERWFTKLPPVLTFELSRFEFNQSLGQPEK
IHNKLEFPQIIYMDRYMYKSKELIRSKRECIRKLKEEIKVLQQKLERYVKYGSGPARFPL
PDMLKYVIEFASTKPASESPTCQSDAHMTLPLSSVHCPVSDLASKESTSKESSSQDVEGT
FSSEDSLPESIAMNKPLTSSRSTMEMPAQPAPRTVTDEEINFVKTCLQRWRSEIEQDIQD
LKNCIASTTQTIEQMYCDPLLRQVPYRLHAVLVHEGQANAGHYWAYIYNQPRQVWLKYND
ISVTESSWEELERDSYGGLRNVSAYCLMYINDKLPHFNAEAAPSEPDQMLGEVDALSVEL
KHYIQEDNWRFEQEVEEWEEEQSCKIPQMDSSTSSASQDFSPSPEPSATSSHGVRCLASE
HAVIVKEQTAQAIANTARAYERSGVEAALSELQEAEPEKPPPPETNLAEQSEQPPKAKDA
ESAAQPNSEASEVEIPSVGRILVRSDADGYDEEVMLSPAMQGVILAIAKARQTFDRDGSE
AGLIKAFHEEYSRLYQLAKETPTSHSDPRLQHVLVYFFQNEAPKRVVERTLLEQFADKNL
SYDERSISIMKVAQAKLKEIGPDDMNMEEYKKWHEDYSLFRKVSVYLLTGLELYQKGKYQ
EALSYLVYAYQSNAALLTKGPRRGVKESVIALYRRKCLLELNAKAASLFETNDDHSVTEG
INVMNELIIPCIHLIINNDISKDDLHAIEIMRNHWCSYLGQDIAENLQLCLGEFLPRLLD
PSAEIIVLKEPPTIRPNSPYDLCSRFAAVMESIQGVSAVTVK
NT seq 3369 nt NT seq  +upstreamnt  +downstreamnt
atgctgttaaaccaactaagagaaatcacaggcattcaggacccctcctttcttcatgaa
gctctgaaggccagtaatggtgacatcacccaagccgtcagccttctcactgaggaaaga
gttaaagagcccagtcaggacacagttgctacagaaccatctgaagtagaggggagtgct
gccaacaaagaagtattagcaaaagtgatagaccttactcatgataacaaagatgatctt
caggctgccattgctttaagtctactggaatcccccaaaattcaagctgatggaagagat
ctgaacaggatgcacgaggcagcctctgcagaaactaaacgctccaagagaaaacgctgt
gaagtctggggagaaaatcccaatcctaatgactggaggagagttgatgggtggccagtt
gggctgaagaatattggcaatacgtgttggtttagtgctgttatacagtctctctttcaa
ctgcctgaatttcgaagacttgttctcagctacagtctgccacagaatgttctcgaaaac
tgtccaagtcacacagaaaagagaaatatcgtgtttatgcaagagctgcagtacttgttt
gctctgatgatgggatcaaatcgcaaatttgtagacccttcagcagccctggatctctta
aagggagcattccgatcacctgaggaacagcagcaagatgtgagtgaattcacacacaag
ctcctggattggctagaggacgcattccagctagctgttaatgttcacagcaatcccagg
aacaaatctgaaaatccaatggtgcagctattctacggtactttcctcactgaaggggtt
cgtgaaggaaagcccttttgtaacaatgagaccttcggccagtatccccttcaggtaaat
ggttatcgcaacttagacgaatgtttggaaggggccatggtggagggtgacattgagctg
cttccttccgatcattcggtgacgtatggacaagagcgttggtttacaaagctacctcca
gtgttgacctttgaactctcaagattcgagttcaatcagtcccttggtcagccagagaaa
attcacaataagctggagtttcctcagatcatttatatggacaggtacatgtacaagagc
aaagagcttattcgaagtaagagagagtgtattcgaaagttgaaggaggaaataaaagtt
ctgcagcaaaaactggaaaggtatgtgaagtacggctcaggcccagctcggtttccactc
ccagacatgctgaaatacgttattgaatttgctagcacaaaacctgcctcagaaagcccc
acatgtcaaagtgatgcacacatgacgttaccactttcttccgtgcactgcccagtttct
gacctggcatccaaggaaagtacaagtaaggaaagctcttctcaggatgttgaaggtacc
ttttcttctgaagattctctacctgagtctattgcaatgaataagccacttacatcttcc
cggtctaccatggaaatgcctgcacagccagctcctcgaactgtcacggatgaggagata
aactttgttaaaacctgtcttcagaggtggaggagtgagattgaacaagatatacaagat
ttaaagaattgtattgcgagcactacccagactattgagcagatgtattgtgaccctctc
cttcgtcaggtgccttaccgcttacatgctgttctcgtccatgaagggcaagcaaatgct
ggacattactgggcctatatttataatcagccccgacaagtctggctcaagtacaatgac
atctctgttactgaatcttcctgggaagaacttgaaagagattcttatgggggcctgaga
aatgttagtgcttactgtctgatgtacattaacgacaagctaccacacttcaacgcagag
gcagccccaagtgaaccagatcagatgttaggagaagtggatgccctgtctgttgagctg
aagcattacattcaggaagataactggaggtttgagcaggaagtcgaggagtgggaagaa
gagcagtcttgcaaaatcccacaaatggactcctccaccagctcagcatcacaggatttc
tctccgtccccagagccttcagcaacctcttctcacggggtccgctgcttggcatccgag
cacgcggtgatcgtgaaggagcagacggcacaggccattgccaataccgcgcgtgcctac
gagaggagcggcgtggaagcggcgctgagcgagcttcaggaagctgaacccgagaagccc
ccgcccccggaaacaaaccttgcagagcagtcagagcagcccccaaaggcgaaggacgca
gagtctgccgcccagcctaattctgaggcctctgaagtcgagattcccagtgtgggaagg
attctggttagatctgatgcagatggatatgatgaggaggtgatgctgagccccgccatg
caaggggtcatcctggccatagctaaagcccgtcagacctttgaccgagatgggtctgaa
gcagggcttattaaggcattccatgaagaatactccaggctctaccagcttgccaaagag
acgcccacttctcacagcgaccctcggctccagcatgtgctggtctactttttccaaaat
gaggcacccaagagagttgtagaacggaccctcttggaacagtttgcagataaaaatctt
agctatgatgaaagatcgatcagcatcatgaaggtggctcaagctaaactgaaggagatt
ggtccagatgacatgaatatggaagagtacaagaagtggcatgaagattatagtttgttt
cggaaagtgtctgtgtatctcctaacaggcctggagctctaccagaaaggaaagtaccaa
gaggcactgtcctacctggtctatgcctaccagagcaatgctgctctgctgacgaagggg
ccccgccgcggggtgaaggaatcggtcatcgctctgtaccgaagaaaatgccttctggag
ctgaatgccaaagcagcttctctctttgaaacaaacgatgaccactctgtaacagagggc
attaacgtgatgaatgagttgatcattccctgcattcaccttatcattaataatgacatc
tccaaggatgacctacatgccattgagatcatgagaaaccattggtgctcttaccttggg
caagatattgctgaaaatctacaactgtgcttaggggagtttctaccaaggctactagat
ccttctgcagaaatcattgtcttgaaggagcctccaactattcgacctaattctccctat
gacctttgtagccgatttgcagctgtcatggagtcaattcagggggtttcagctgtgaca
gtgaaataa

DBGET integrated database retrieval system