KEGG   Canis familiaris (dog): 489427Help
Entry
489427            CDS       T01007                                 

Gene name
GRIA4
Definition
glutamate receptor, ionotropic, AMPA 4
Orthology
K05200  
glutamate receptor 4
Organism
cfa  Canis familiaris (dog)
Pathway
Neuroactive ligand-receptor interaction
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Dopaminergic synapse
Amphetamine addiction
Nicotine addiction
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:cfa04080]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:cfa04724]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:cfa04728]
Organismal Systems; Nervous system; Retrograde endocannabinoid signaling [PATH:cfa04723]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:cfa04713]
Human Diseases; Substance dependence; Amphetamine addiction [PATH:cfa05031]
Human Diseases; Substance dependence; Nicotine addiction [PATH:cfa05033]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 902 aa AA seqDB search
MRIICRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQHGWH
VSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIA
NLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSAL
TYDGVLVMAETFRNLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGN
VQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVT
TIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTK
IWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL
DPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLW
FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED
LAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKG
KFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGV
LDKLKNKWWYDKGECGPKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKS
RAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHTGTAIRQSSGLAVIASD
LP
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgaggattatttgcagacagattgtcttgttgttttctggattttggggactcgccatg
ggagcctttccgagcagcgtgcaaataggtggtctcttcatccgaaacacagatcaggaa
tacacggcttttcgattagcaatttttcttcataacaccagccccaatgcgtcggaagct
ccttttaatttggtacctcatgtggacaacattgagacagccaacagttttgccgtgaca
aatgctttctgttcccagtattctagaggagtttttgccattttcggactctacgataag
aggtcggtgcacaccttgacctcgttttgcagcgccttacacatctcgctcatcacaccg
agcttccccacagagggggagagccagtttgtgctgcagctcaggccttctttgcgggga
gcgctcctgagcctgctggatcactatgaatggaactgctttgtcttcctgtacgacacg
gacagggggtactcaatacttcaagctattatggaaaaagcaggacaacatggttggcat
gtcagcgccatctgtgtggaaaattttaatgatgtcagctatagacaacttctagaggaa
cttgacagacgacaagagaagaaatttgtaatagactgtgagatagagaggcttcaaaac
atattagaacagattgtgagtgttgggaagcatgtaaaaggctaccattacatcattgca
aacttgggattcaaggatatttctcttgagagatttatacatggtggagccaatgttaca
ggattccagttggtcgattttaacacacctatggtaaccaaactaatggatcgctggaag
aaactagaccagagagagtatccaggatctgagactcctccaaaatacacatctgctttg
acttatgatggagtccttgtgatggctgaaacatttcgaaatctcagaagacaaaaaatt
gatatttcaaggagaggaaatgcgggggattgtctggcaaatcctgctgctccctggggc
cagggaattgacatggagaggacgctcaaacaggttcgaattcaaggactgacagggaac
gttcagtttgaccactatggacgtagagtcaattacacaatggatgtgtttgagctaaag
agcactgggcccagaaaggttggttactggaatgatatggataaattggtcttgattcaa
gatgtacccactcttggcaatgacacagcagctattgagaacagaacagtggttgtaacc
acaattatggaatccccatatgttatgtacaagaaaaatcacgaaatgtttgaaggaaat
gacaagtatgaaggatactgtgtagatttggcatctgaaattgcaaaacatattggtatc
aagtataaaattgccattgtccctgatggaaagtatggagcaagggacgcggacacaaaa
atctggaatgggatggtaggagaacttgtttatgggaaagcagaaattgctattgcccct
ctgacaatcactttggtccgagaggaggtcattgacttctctaagcccttcatgagcttg
ggcatctctataatgatcaaaaagcctcagaaatctaaaccaggagtgttttccttcttg
gatcctctggcctatgagatttggatgtgcatagtctttgcctacattggtgtcagcgtg
gtcttattcctagttagcaggtttagtccatatgagtggcatacagaagagccagaggat
ggaaaggaaggacccagcgaccagcctcccaatgagtttggcatctttaacagcctctgg
ttttccctgggtgcctttatgcagcaaggatgtgacatttcacccagatccctctcaggt
cgaattgttggaggtgtttggtggttctttacactcatcattatatcatcttataccgct
aacctcgccgctttcctgacggttgagcgaatggtctcccccatagaaagtgcggaagac
ctggccaaacaaacagaaattgcctatggaacactggattcagggtcaaccaaagaattc
ttcagaagatccaaaatcgcggtgtacgagaagatgtggacgtacatgcggtcggcggag
ccgtcggtgttcacgcggaccacggcggagggcgtggcgcgcgtgcgcaagtccaagggc
aagttcgccttcctgctggagtccacgatgaacgagtacatcgagcagcgcaagccctgc
gacaccatgaaagtgggaggaaacctggattccaagggctatggcgtagctactcccaag
ggctcctcattaagaactcctgtaaaccttgccgttttgaaactcagtgaggcaggcgtc
ttagacaagctgaaaaacaagtggtggtacgataaaggtgaatgtggacccaaggactct
ggaagcaaggacaagacaagcgccttgagcctgagcaacgtagcaggcgtcttctacatt
ctggttggcggcttgggcttggcaatgctggtggctttgatagagttctgttacaagtcc
agggcagaggcgaagagaatgaagctgaccttttctgaagccataagaaacaaagccaga
ttatccatcactgggagtgtgggtgagaacggccgcgtgttgacgcccgactgccccaag
gctgtacacacggggactgcgattagacaaagttcaggattggctgtcattgcatcggac
ctaccataa

DBGET integrated database retrieval system