KEGG   Canis familiaris (dog): 489429Help
Entry
489429            CDS       T01007                                 

Gene name
MMP8
Definition
(RefSeq) matrix metallopeptidase 8
  KO
K01402  matrix metalloproteinase-8 (neutrophil collagenase) [EC:3.4.24.34]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.34  neutrophil collagenase
     489429 (MMP8)
Peptidases [BR:cfa01002]
 Metallo Peptidases
  Family M10
   489429 (MMP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Reprolysin_3 Reprolysin_5 Reprolysin_4 DUF4953 Peptidase_M54 Metallopep Peptidase_M66 Reprolysin_2
Motif
Other DBs
NCBI-GeneID: 489429
NCBI-ProteinID: XP_546547
Ensembl: ENSCAFG00000023335
UniProt: F1PVR0
Position
5
AA seq 476 aa AA seqDB search
MAAFADKATLDLRKLPLLLLLCVQLSHTFPVRGESPEEKSTRVVQDYLEKFYQLPRNRFQ
SERKNSTSVIMEKLREMQRFFGLNETGKPNQETLEMMQKPRCGVPDSGDFMLTPGNPKWK
QTNLTYRIIKYTPQLSEANVETAIQKAFQVWSNVSPLTFTKVSQGEVDIRISFVQGDHGD
NSPFDGPNGILAHAFQPGQGIGGDVHFDAEETWTENSSNYNLFLVAAHEVGHSLGLSHST
DPGALMYPNYVFHDPSTYTLPQDDINGIQTIYGPSSNPVQPTGPSTPTTCDPRLTFDAIA
TLRGEILFFKDKYFWRRHPQLPRVELNFISLFWPSLPDGIQAAYEDVDKDLVFLFKGSQY
WALSGYDIKQGYPKDISDYSFPSSVQAIDAAVYYRRKTYFFVNDQVWRYDNQRQSMEPGY
PKSIASIFPGIESTVDAVFQQNHVFLFFSGPRYYAFDLGAHEVIRVGRSNRWLNCR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgtttgcagataaggccacgttggacctgaggaagctcccacttctgctcctg
ctctgcgtgcagctctcacacacctttccagttcgaggggagtccccagaagagaagagc
acacgagttgttcaggactacctagaaaagttctaccagttacccaggaacagattccag
tctgagaggaagaacagcaccagtgtgattatggaaaagctcagagagatgcagcgattc
tttgggttgaacgagacggggaagcccaatcaggagaccctggagatgatgcagaagcct
cgctgcggagtgcccgacagcggtgattttatgttaaccccggggaaccccaagtggaaa
caaactaacctgacctacaggattattaagtacaccccacagttgtcagaggccaatgtg
gagacagctattcagaaagcctttcaagtatggagtaatgtatcacccctgaccttcacc
aaggtctcacagggagaagtggacatcaggatctctttcgtccaaggagatcatggtgac
aattcgccatttgacggacccaatggaatcctcgctcatgcctttcagccgggccaaggt
attggaggagatgttcacttcgatgcagaagaaacatggaccgaaaattctagcaattat
aatttgtttcttgttgctgcccatgaagttggccattccttggggctctctcattccact
gaccctggtgccttgatgtatcccaactatgttttccacgaccccagcacctacaccctc
cctcaagatgacatcaatggcattcagaccatctacggtccttcaagcaaccctgtccaa
ccaactggaccaagcacacccacaacttgtgaccccagactgacatttgatgctatcgcc
acactccgtggagaaatactattctttaaagacaagtacttctggaggaggcacccacag
ctgccaagagtggaactcaacttcatttctctgttctggccatccttgcctgacggtata
caggcggcctatgaggatgtggacaaggacctcgttttcctgtttaaaggcagccagtac
tgggctctgagtggctatgatatcaagcaaggttatcccaaggatatctcagactacagc
ttcccaagcagcgtccaagccatcgatgcagctgtttactacaggagaaaaacctacttc
tttgtaaatgaccaagtctggagatatgataaccaaagacagtccatggaaccaggttac
cccaaaagcatagcaagtatctttccaggaatagaaagcacagttgatgcagttttccag
cagaatcacgtcttccttttcttcagcggaccaagatattatgcatttgatcttggtgct
cacgaggttattagggttggtagatccaacagatggctcaactgtagataa

DBGET integrated database retrieval system