KEGG   Canis familiaris (dog): 489688Help
Entry
489688            CDS       T01007                                 

Gene name
MLYCD
Definition
malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
cfa  Canis familiaris (dog)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    489688 (MLYCD)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    489688 (MLYCD)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    489688 (MLYCD)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    489688 (MLYCD)
Enzymes [BR:cfa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     489688 (MLYCD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 499 aa AA seqDB search
MRGLGPALTARRLFPLRLPPRPPRPAGPRVSSGAAAAAAGAPERAMDELLRRAVPATPAY
ELREKTPAPAEGQCADFVSFYGGLAEAAERADLLSRLARGFGVDHGQVAEQSAGVLQLRE
QPREAAVLLQAEDRLRYALVPRYRGLXHHISKLDGGVRFLVRLQADLLEAQALKLLEGPH
VREMNGVLKAMLSEWFSSGFLSLERVTWHSPCEVLQKISESEAVHPVKNWMDMKRRVGPY
RRCYFFSHCTTPEEPLIVLHVALTGDISNNIQAIVKECPPSETEDRSKISAAIFYSISLT
QPGLQGVELGTVLVKRVLKELQKEFPHLGTFSSLSPIPGFTKWLLGLLSSQGKEHGRSEL
FTDAECKEISEITGGPINETLKVLLSSSEWIKSEKLVRALQAPLMRLCAWYLFGEKHRGF
ALNPVANFHLQNGAVIWRINWMADVSLKGITGSCGLMVNYRYYPAETATNSTSYLCSKNI
KASEQVLSLVAQFQKNSKL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgcgaggcctggggccggcgctgacggcgcggcgcctcttcccgctgcggctgcccccg
cggccgccgcggccggccggaccccgggtgtcgagcggggcggcggcggcggcggcgggc
gccccggagcgggccatggacgagctgctgcgccgcgccgtgcccgccacgccggcctac
gagctgcgcgagaagacgccggcgccggccgagggccagtgcgcggacttcgtgagcttc
tacggcggcctggccgaggcggccgagcgcgccgacctgctgagccgcctggcgcgcggc
ttcggcgtggaccacggccaggtggccgagcagagcgccggcgtgctccagctgcgcgag
cagccgcgggaggcggccgtgctgctgcaggcggaggaccggctgcgctacgcgctcgtg
ccgcgctaccgcggcctcnttcaccacatcagcaagctggacggcggcgtgcgcttcctg
gtgcggctgcaggccgacctgctcgaggcgcaggcgctcaagctgctggagggcccgcac
gtccgggagatgaatggagtgctgaaggctatgctctcagagtggttctcttcgggcttc
ctaagcctagaacgggtcacctggcactcgccttgtgaggtgctgcagaaaatcagtgag
tcggaggctgtgcatcctgtgaaaaattggatggacatgaagcgccgcgttgggccgtac
agaagatgttacttcttttctcactgcacaacccccgaggaacccttgattgtgctgcac
gtggcattgaccggtgacatctccaacaacatccaggccatagtgaaggagtgtcctccc
tcggagacggaggacaggagtaagatctctgcggccatcttctactccatcagcctgaca
cagcctggactgcaaggtgtggagctgggcactgtcctggtcaagcgagtgctcaaggag
ctgcagaaagagtttcctcatcttgggacattttcaagcctgtctcctatacctggattc
accaagtggcttctcggactcctgagctcacaaggaaaggaacacgggaggagtgaactg
tttacagatgccgaatgtaaagaaatctctgagatcacaggcggtcccattaatgagacc
ctcaaggtccttctcagcagcagcgagtggatcaagtctgaaaagctggtcagggcactc
caggcccctttgatgaggctctgtgcgtggtacttatttggagaaaagcaccggggcttt
gccctgaaccctgtggcaaacttccacctgcagaatggggctgtgatctggcgcatcaac
tggatggccgatgtgagcctcaagggcatcactggctcctgcggcctgatggtcaactac
cggtactacccagcagagacggccacaaacagcaccagctacctctgctcaaagaacatc
aaagcttccgagcaggtcctcagccttgtggcccagtttcagaagaacagcaaactttaa

DBGET integrated database retrieval system