KEGG   Canis familiaris (dog): 489692Help
Entry
489692            CDS       T01007                                 

Gene name
PLCG2
Definition
phospholipase C, gamma 2 (phosphatidylinositol-specific)
Orthology
K05859  
phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
cfa  Canis familiaris (dog)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Ras signaling pathway
Calcium signaling pathway
NF-kappa B signaling pathway
HIF-1 signaling pathway
Phosphatidylinositol signaling system
VEGF signaling pathway
Osteoclast differentiation
Platelet activation
Natural killer cell mediated cytotoxicity
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Inflammatory mediator regulation of TRP channels
Thyroid hormone signaling pathway
Epstein-Barr virus infection
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Glioma
Non-small cell lung cancer
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    489692 (PLCG2)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    489692 (PLCG2)
   04012 ErbB signaling pathway
    489692 (PLCG2)
   04370 VEGF signaling pathway
    489692 (PLCG2)
   04064 NF-kappa B signaling pathway
    489692 (PLCG2)
   04066 HIF-1 signaling pathway
    489692 (PLCG2)
   04020 Calcium signaling pathway
    489692 (PLCG2)
   04070 Phosphatidylinositol signaling system
    489692 (PLCG2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    489692 (PLCG2)
   04650 Natural killer cell mediated cytotoxicity
    489692 (PLCG2)
   04662 B cell receptor signaling pathway
    489692 (PLCG2)
   04664 Fc epsilon RI signaling pathway
    489692 (PLCG2)
   04666 Fc gamma R-mediated phagocytosis
    489692 (PLCG2)
   04670 Leukocyte transendothelial migration
    489692 (PLCG2)
  Endocrine system
   04919 Thyroid hormone signaling pathway
    489692 (PLCG2)
  Nervous system
   04722 Neurotrophin signaling pathway
    489692 (PLCG2)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    489692 (PLCG2)
  Development
   04380 Osteoclast differentiation
    489692 (PLCG2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    489692 (PLCG2)
   05206 MicroRNAs in cancer
    489692 (PLCG2)
   05205 Proteoglycans in cancer
    489692 (PLCG2)
   05214 Glioma
    489692 (PLCG2)
   05223 Non-small cell lung cancer
    489692 (PLCG2)
  Infectious diseases
   05169 Epstein-Barr virus infection
    489692 (PLCG2)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     489692 (PLCG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 1336 aa AA seqDB search
MGKLRLSVGTRRAQGRERWPERGAASVALPVPARERPPPGGSPALAACTGRSGVQGAPPS
SSLTAPPILPTMTALAHVDSLPEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMET
RQVAWSKTADKIEGFLDIMEIKEIRPGKNSKDFERAKAVRQKEECCFTILYGTQFVLSTL
SLAADSKEDANKWLSGLKILHQEAMSASTPTIIESWLRKQIYSVDQTRRNSISLRELKTI
LPLVNFKVNSAKFLKDKFVEIGAHKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFI
LGNTDRPDASAVHLHDFQRFLLHEQQELWAQDLNKVRARMTKFIDDTMRETAEPFLFVDE
FLTYLFSRENSIWDEKYDVVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYIRCL
RMGCRCIELDCWDGPDGKPIIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHC
CVEQQRHMARVFKEVFGDQLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNME
DKKDEHKQQGELYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTAEEELPQDTPPTELHFG
EEWFHKKVEKRTSAEKLLQEYCAETGGKDGTFLVRESKTFPNDYTLSFWRSGRVQHCRIR
STVEGGTMKYFLTDNVMFTSIYALIQHYRETHLRCAEFELRLTDPVPNPNPHESKPWYYD
GLSRGEAEDMLMRVPRDGAFLIRRREGTDSYAITFRARGKVKHCRIHRDGQHFVLGTSAY
FESLVELVSYYEKHALYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSM
PQRTVKALYDYKAKRSDELSFCRGALIHNVSKEPWGWWKGDYGTRIQQYFPSNYVEDIST
VDVEELEKQIIEDNPLGSLCRGILDLNTYNVVKAPQGKNQKPFVFILEPKKQGDPPVEFA
TDKVEELFEWFQSIREITWKIDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLEN
PDFREIRSFVETKADSVVRQKPVDLLKYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQM
VALNFQTPDKYMQMNHALFSLNGRTGYVLQPESMRTEKYDPMPPESQRKILMTLSVKVLG
ARHLPKLGRSIACPFVEVEICGAEYDNNKFKTTVVNDNGLSPVWAPTQEKVTFEIYDPNL
AFLRFVVYEEDMFSDPNFLAHATYPIKGIKSGFRSVPLKNGYSEDIELASLLVFCEMQPV
LESEEELYSSCRQLRRRQEELNNQLFLYDTHQNLRNANRDALVKEFNVNENQLQLYQEKC
NRRLREKRVSNSRFYS
NT seq 4011 nt NT seq  +upstreamnt  +downstreamnt
atggggaaactgaggctgagcgtaggtacgcggcgtgcccaaggtcgcgagcggtggcct
gagcgcggcgcggcctcagtggcccttcccgttccggcccgagagcggccacctccaggt
ggttctccggcgctcgcggcctgcacggggcgcagcggggtgcagggggcgcccccgtcc
tcttccctcactgctccccccattctgccaacaatgactgccctggcccacgtggacagc
cttccggaatacgagaagagtcagatcaagagagccctggagctgggcacggtgatgacg
gtgttcagcttccgcaagtccaccccagagcggaggactgtccaggtgatcatggagaca
cgccaggtggcctggagcaagacagccgacaagatcgagggcttcttggatatcatggaa
atcaaggaaatccgcccagggaagaactccaaggattttgagcgtgcaaaagcagtccgc
cagaaggaagagtgctgttttaccatcttgtacggcacccagtttgttctgagcacactc
agtctggcagctgactctaaagaagatgcgaataagtggctctctggcttgaaaatctta
caccaggaagcgatgagtgcatctacacccaccattattgagagttggctgagaaagcag
atttattcagtggaccaaaccagaagaaacagcatcagcctccgagagttgaagaccatc
ttacccctggtcaactttaaggtgaacagtgccaagttcctcaaagataagtttgtggaa
attggtgcacacaaagatgagctcagctttgagcagttccacctgttctataaaaaactt
atgtttgagcagcaaaagtcgattcttgatgaattcaaaaaagattcttccgtgttcatc
ttgggcaacactgaccggccggacgcctctgctgttcacctgcacgacttccagcgcttt
ctcttacatgagcaacaggagctttgggctcaggatctgaacaaagtccgtgcgcggatg
acaaagtttatcgatgacaccatgagggaaacagccgagcccttcttgtttgtcgatgag
ttcctcacatatctgttttcgcgggagaacagcatctgggatgagaagtatgacgtggtg
gacatgcaggacatgaacaaccccttgtcccattactggatctcctcttcgcataacacg
tacctcaccggtgaccagctacggagtgagtcatccacagaagcgtacattcgctgcctg
cggatgggctgtcgctgcattgagttggactgctgggacgggcccgatgggaagcccatc
atctaccacggctggacacggaccaccaagataaagtttgacgacgtcgtgcaggccatc
aaagaccatgcctttgtcacttcaagcttccccgtgatcctgtccatcgaggagcactgt
tgcgtggagcagcagcgccacatggccagggtgttcaaggaggtgtttggcgaccagctg
ctgacgaagcccacggaggccagtgctgaccagctgccctcgcccagccagttgcgggag
aagatcatcatcaagcataagaagctgggtccccgaggggacgtggatgtcaacatggag
gacaagaaagatgagcacaagcaacagggtgaactgtatatgtgggattccatcgaccag
aaatggactcggcactactgtgccatcgccgatgccaaactgtctttcagcgatgacatt
gagcagactgcagaagaggagctgccccaggacacaccccccacggagctgcattttggg
gaggagtggttccacaagaaagtagagaagaggacgagtgccgagaagctgctgcaggaa
tactgtgcagagaccgggggcaaggatgggactttccttgtgcgggagagcaagaccttc
cccaatgactacaccctgtccttctggcggtccggccgcgtccagcactgccggatccgt
tccaccgtggaggggggcaccatgaagtacttcctgactgacaacgtcatgttcaccagc
atctacgccctcatccagcactaccgcgagacccacctgcgctgcgccgagttcgagctg
cggctcaccgaccctgtgcccaaccccaacccccacgagtccaagccgtggtactacgac
gggctgagccgtggggaggcagaggacatgctaatgagggtgccccgggacggcgccttc
ctgatccggaggcgagaaggtaccgattcctacgccatcaccttcagggccaggggcaag
gtgaagcactgccgcattcaccgggatggccagcactttgtgctggggacctctgcctac
ttcgagagcctcgtggagctagtcagctactacgaaaagcacgcgctctaccgaaaaatg
cgactgcgctaccccgtgacgcctgagctcctggagcgctacaatatggaaagagatata
aactccctctatgacgtcagcagaatgtatgtggatcccagtgagatcaatccttctatg
cctcagagaaccgtgaaagctctgtatgactacaaagccaagcgaagcgatgagctgagt
ttctgccgtggggccctcattcacaacgtctcgaaggagccctggggctggtggaagggg
gactatggaaccagaatccagcagtacttcccatccaattacgtcgaggacatttcaacg
gtcgacgtggaggagctggagaagcagattattgaagacaatcccttagggtctctttgt
aggggaatactggatctcaatacctataacgttgtgaaagccccccaggggaaaaaccag
aagccattcgtgtttatcctggagcccaagaagcaaggtgaccccccggtggagtttgcc
acggacaaggtggaggagctctttgagtggtttcagagcatccgggagatcacctggaag
atagacaccaaggagaacaacatgaagtactgggagaagaaccagtccatcgccatcgag
ctctcggacctggtcgtctactgcaagccaaccagcaagaccaaggacaatttagaaaac
cctgacttccgagaaatccggtcctttgtggagacaaaggcagacagtgtcgtcagacag
aaacccgttgacctcctgaagtacaatcagaagggcctgacccgtgtttacccgaaggga
cagagggtggactcctccaactacgacccctttcgcctctggctgtgcggctcccagatg
gtggcactcaatttccagactccagacaagtatatgcagatgaatcacgccttgttctca
ctcaatgggcgaacgggctacgtcctacagcctgagagcatgaggacggagaagtatgac
cccatgccacctgagtcccagaggaagatcctgatgactctgtcagtcaaggttcttggg
gctcgccatctccccaaacttggacgaagtatcgcgtgtccctttgtggaggtggaaatt
tgtggagctgaatatgacaacaacaagtttaagacaacagtcgtgaatgacaatggccta
agccctgtttgggctccaacacaggagaaagtgacctttgaaatttacgaccccaacctg
gcgtttctgcgctttgtggtctatgaggaagatatgttcagtgaccccaatttccttgct
cacgccacttaccccatcaaaggaatcaaatcaggattcagatctgttcctctgaagaac
gggtacagtgaagacattgagctggcttccctcctggttttctgtgagatgcagccagtc
ctggagagcgaagaggaactttattcctcctgtcgccagctgcgaaggcggcaggaagag
ctcaacaatcagctctttctgtacgacacacaccagaacttgcgcaacgccaaccgggat
gccctcgttaaagagttcaatgtcaacgagaaccagctccagctgtaccaggagaagtgc
aaccggaggttgagagagaagcgagtcagcaacagcaggttttactcctag

DBGET integrated database retrieval system