KEGG   Canis familiaris (dog): 489695Help
Entry
489695            CDS       T01007                                 

Gene name
BCMO1
Definition
beta-carotene 15,15'-monooxygenase 1
Orthology
K00515  
beta-carotene 15,15'-monooxygenase [EC:1.14.99.36]
Organism
cfa  Canis familiaris (dog)
Pathway
Retinol metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:cfa00830]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 546 aa AA seqDB search
MDIIFGRNKKEQLEPVRAKVTGRIPTWLQGTLLRNGPGMHTVGETRYNHWFDGLALLHSF
TIRDGEVYYRSKYLRSDTYKDNIEANRIVVSEFGTMAYPDPCKNIFSKAFSYLSHTIPDF
TDNCLINIMKCGEDFYATTETNYIRKINPHTLETLEKVDYRKFVAVNLATAHPHYDEAGN
VLNMGTSIMDKGKTKYVIFKIPATVPEDKKEKNPLKHTEVFCSITSRSLLSPSYYHSFGV
TENYVIFLEQPFKLDILKMSTAYIRGVNWASCMAFHKEDKTYIHIIDQRTRKPVPTKFYT
DPMVVFHHVNAYEEDGCLLFDVIAYEDSSLYQLFYLANLNQDFEENSRLTSIPTLRRFAV
PLNVDKNAEVGSNLIKLASTTARALKEKDDQVYCQPELLYEGLELPRINYAHNGKRYRYI
FAAEVQWSPIPTKILKYDVLTKSSLKWGQEHCWPAEPLFVPTPGAKDEDDGIILSAIVST
DPQKLPFLLILDAKSFTELARASIDVEMHLDLHGLFIPDTDCNTGKQAPSQEEQDRAPDC
HAAPQI
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggatataatatttggcagaaataagaaggagcagctggaacctgtgcgggccaaagtg
acaggcaggattccaacatggctgcagggcaccctgctccgtaacgggcctggaatgcac
acagtgggagagaccagatacaaccattggttcgatggcctggccttgctccatagcttc
acaatcagagatggtgaagtttattacaggagcaaatacctgagaagtgatacctacaaa
gacaacatcgaggccaacaggattgtggtgtcagagtttggaacgatggcctacccagac
ccctgcaaaaacatattttctaaagctttctcctacttgtcccataccatccctgatttc
acagacaattgcctgattaacatcatgaagtgtggggaagacttctatgcgaccacagag
accaattacatcaggaaaatcaacccacatactctggaaaccctggagaaggttgattat
cgcaagttcgtggctgtaaatctggcaacagcacatcctcattatgatgaagctggaaat
gttcttaatatgggcacgtccatcatggacaaggggaagacaaaatatgtgatctttaaa
atccctgccacagtcccagaggacaagaaggagaagaaccccttgaagcacacggaggtg
ttctgctccatcacctcccgctccctcctctccccgagctattaccacagcttcggagtc
acggagaactacgtcattttcctcgagcagcctttcaagctggatatcctcaaaatgtca
actgcgtacatccggggagtgaactgggcttcctgcatggctttccacaaggaagacaag
acttatattcacatcatcgaccaaaggaccaggaaacctgtgcccaccaagttttacacg
gaccccatggtggtctttcatcacgtcaatgcctacgaggaggatggctgccttctcttt
gacgtcattgcctacgaggacagcagcctttaccagctcttctacttggccaacctgaac
caggactttgaggagaactcaaggctaacctccatccccaccctcaggaggtttgctgtg
cctctcaatgtggacaagaatgcagaggtgggctcaaatctaatcaaactggcatctaca
acagcaagagccctgaaggaaaaggatgaccaagtctactgccagccggagttgctttat
gaaggtttagagctgcctcggatcaattatgctcacaatgggaagcgataccgctatatc
tttgctgctgaagttcagtggagtcccatcccaaccaagatactgaaatatgatgttctc
acaaagtcatccttaaaatggggacaggaacactgctggccagcagaacccctgtttgta
cccacaccgggtgccaaggacgaggatgatgggattatcttatcagccatcgtctctact
gatccccaaaagctgccttttctacttattctggatgccaaaagttttacagaattagcc
cgtgcatctattgatgtagagatgcacctggatctccatgggctattcatcccggacaca
gactgcaacaccgggaagcaggccccttcccaggaagagcaggacagggctccggactgc
cacgcggccccacagatctga

DBGET integrated database retrieval system