KEGG   Canis familiaris (dog): 489769Help
Entry
489769            CDS       T01007                                 

Gene name
CES2
Definition
carboxylesterase 2
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
cfa  Canis familiaris (dog)
Pathway
Drug metabolism - other enzymes
Class
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:cfa00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 572 aa AA seqDB search
MRLDGFRARLSAVVCGLLLPLVLGRGQDSASPIRTTHTGQVRGSLVHVEGTDVGVHTFLG
IPFAKPPLGPLRFAPPEPPEPWSGVKDGTSHPAMCVQNITTANAVALKLLNMTLPLTSMS
EDCLYLSIYTPAHASEGSNLPVSVWIHGGSLMIGMASMYDGSALVAFEDLVVVIIQYRLG
VLGFFSTGDKHATGNWGYLDQVAALRWIQQNIAYFGGDPGCVTIFGGSAGGISVSLHVVS
PMSQGLFHRAIMESGVALLPGLTVSSSDEVTTRVAKLSGCGQVDSEALVGCLRSKSEEEI
LAISKHFKFFPAVVDGTFLPRHPQELLAFADFQPVPSIIGVNNNEFGWLLPLVHGLLEKM
GQMSPEDILAILRHYLANLDVPPELMPSITDEYLGSSSDAEARRDDFQELLADIIMNLPA
LNFSRSFXGRDPGSPPFFFFYEFQHXPSSFVKIKPAWVRADHGAEVAFIFGGHFLMDESS
LQAFPEATEEEKQLSLTMMAQWTQFARTGDPNGEGLPPWPSFNQLGQHLEISLTPRVGQK
RREAQMRFWTETFPAKIWLQQMQKGRKGQDEL
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgcggttggacgggtttcgcgcgcggctgagcgccgtggtctgtgggctcctgcttccc
ctagtcctgggccggggccaggactctgctagccccatccggaccacacacacagggcag
gtgcgagggagcctcgtccatgtggaaggcaccgatgtgggagtccacaccttcctggga
attccttttgccaagccgcctctagggccactacgatttgcaccccctgagccccctgag
ccttggagtggtgtaaaagatgggacctcccacccagccatgtgtgtgcagaacatcact
actgcaaatgcagtggctctgaaattgctgaatatgaccctgcctctcacctccatgtcc
gaggactgcttataccttagcatctatacacctgcccatgccagtgaaggctccaatctg
cctgtgtcggtgtggatccacggtggttcgcttatgataggcatggcttccatgtatgat
ggctccgcactggtagcctttgaggacttggtggttgtcattatccagtaccgcctgggt
gtgctgggcttcttcagcactggagacaagcatgcaactggcaattggggctacctggat
caagtggccgcgctacgctggatccagcaaaatattgcctattttggaggagaccctggc
tgtgtcaccatttttggggggtccgcaggtggcataagcgtgtccttacatgttgtgtcc
cccatgtcccaaggactcttccatcgtgccatcatggagagtggtgtggccctgttgccc
ggcctcactgtcagctcctctgatgaggtcaccacgagggtggccaagctgtctgggtgt
ggccaagttgactcagaggccctggtgggctgcctgagaagcaagagcgaggaggagatt
ctggccatcagcaagcacttcaagttcttccctgctgtggtggatgggaccttcctgccc
aggcacccccaggagctgctggcctttgctgactttcaacctgtccccagcatcattggt
gtcaacaacaatgagttcggttggctcctccccttggtccatggtttgctggaaaagatg
ggacagatgagcccagaggatatattggccatattaagacactacttggccaatctggat
gtgccccctgagctgatgcccagcatcacagatgaatacctaggcagcagttctgatgca
gaagccagacgcgacgacttccaggaacttctggctgacattatcatgaacttgcctgcc
ttgaatttctctagaagcttctaagggcgtgatcctggatccccgccttttttttttttt
tatgagttccagcattgacccagttcctttgtgaagatcaagccagcgtgggtgagggct
gaccatggggctgaggttgccttcatatttgggggtcacttcctcatggatgagagctcc
ctgcaggcctttccagaagctacagaggaagagaagcagctgagcctcaccatgatggct
cagtggactcaatttgcccggacaggggaccccaatggtgaggggctgcctccttggccc
tcattcaatcagttggggcaacacctggaaatcagcctgacgccacgagttggccagaag
cgaagagaagcccaaatgcggttttggacagagacatttcccgccaagatctggctgcag
cagatgcagaagggcaggaaggggcaggatgagctctga

DBGET integrated database retrieval system