KEGG   Canis familiaris (dog): 489812Help
Entry
489812            CDS       T01007                                 

Gene name
POM121, POM121C
Definition
(RefSeq) nuclear envelope pore membrane protein POM 121C
  KO
K14316  
nuclear pore complex protein Nup121
Organism
cfa  Canis familiaris (dog)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    489812 (POM121)
Messenger RNA biogenesis [BR:cfa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     489812 (POM121)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
6
AA seq 1214 aa AA seqDB search
MSPAAAAAGGGERRRPIASVRDGRGRGGGCGGPAGAVVLGLSLFGLVLYLVPAAAALAWL
AVGATAAWWGLSREPRGSRALSSLVRNARRQRPLHASPPAKSAVNGNLLESRTLLEGPDP
AELLLMGSYLGKPGPPQPAPAPEARDLLERPGRRRAPARAAPPAHSAHLVHHTHPSLPTP
LLRPPRRPSHRDCGTLSNRFVITPRRRYPIQQAQYSLLGVLPTVCWNGYHKKTVLSARNS
KMVCSPVTVRIAPPDSKWIRSPIPEQTINSTLSSPSSNAPDPCAKETVLSALKERKKRTV
EEEDQIFSDSQENKRRRHDSSGSGHSAFEPLVANGVPAAFVPKPGSLKRGLNSQSSDDHS
NKRSRTSSMSSLTSTYTGGIPSSSRNAITSSYSSTRGFSQFWKRSGPSSSPFSSPASSRS
QTPERPAKKIREDELSHHSSSSTPLAADKEAQGEKAADTTTSKAQNSWSSPPTPGSSGQR
KRKIQLLPSRRGARLTLPPPPQLGYSITAEDLDLEKRASLRWFNKALADGTDTSSNSVTE
KPPTTQPSLTFTPPAAGTTTSPATLPAPNTNPLLESLKKMQSSASLPSSSESAGVATTVA
PSPPKTPSLLPSLSSSQSGALPGASSDSKSTATFSGLTPAASLTPATDTTKSPLAPQAET
SAKPAAPPTPSPTPKQSLLLGMLSTPPADPPASTPPTVSSASPMFKPIFMAPPKSENEGP
LPSSPSKVTTTTPSSSALLAPTSSPQPVFKPIFGNMGPPTSTPLSAAFFSQTTASAGRDA
STPLFPSQASATSTVAPVSAASTSIDSASKPTFSFGVSTVTSTTTSAAQPFLFGPPPTSG
ASFSPAIGSIFQFGKPPVAPVSDNVTTFGQSVPGAVQTATSSSSSSSSSSSASACFSGFS
GSLTTPAPATSSQPALTFTTTTTPAFHIPFGSSTKPTLPSYPGANPQPTFGATDGQQQGA
TKPGLAPSFGSSFTFGNTAAAAPAATPAPGPAQPTFGSPAQASFGGLKPTAPAFGTPANT
QPAFGSTTSVFSFGAASTSGFGATTQTTSSGTGSSMFGSTTLSPFTFGGSAGPASSGGFG
INVATPGTSGAFSFGTGQSGAAASTTPFGGGLSQSTLGAPSQSTPFAFNVASTPESKPVF
GGTSTPSFGQNTPAPGVGVSGSGLSFGASSTPTQGFVGVGPFGSAAPSFSIGAGSKTPGA
RQRLQARRQHTRKK
NT seq 3645 nt NT seq  +upstreamnt  +downstreamnt
atgtctccggcggctgcggcggctggcggaggcgagcggcggcggccgatagcgagcgtc
agggacggccggggccggggagggggctgcggcggcccggccggggcggtggtcctcggc
ctgtcgctgttcggcctcgtgctgtacctggtgccggcggcggcggcgctggcctggctg
gccgtgggggccaccgcggcctggtggggactgagccgcgagccccgcggttcgcgcgcc
ctttcctctctcgttcggaacgcgcggcgtcagcggcccctgcacgcctcgcctccggct
aagtcggcggtgaacggaaacctcctagagtcgcggaccctgctcgaaggaccggacccc
gccgaactgctcctcatgggcagttacctgggcaagcccggccccccgcagcctgcaccc
gccccggaggccagggacctactggagaggcctggccgccgccgagcacccgctcgcgcc
gcgccgcctgcgcactcggcccatcttgtgcaccacactcacccctctctccccactcct
cttctccgaccccctaggaggccttcccaccgggattgtgggactttatcaaaccggttt
gtaataacacctcgaagacgatatccaatccagcaggcccaatattcccttctgggggta
cttcctacagtgtgctggaatggttatcacaagaagactgtgctatctgctcgtaattcc
aaaatggtgtgcagcccagtgacagtgaggattgctcctccagatagtaaatggattcgt
tcaccaataccagagcagacaatcaactcaacgctgtcctcaccatcaagtaatgcccca
gatccatgtgcaaaggagaccgtactgagtgccctcaaagagaggaagaaaaggacagtg
gaggaggaagatcaaatattttctgatagccaggaaaataaaagaaggcgccatgatagc
agcgggagtggacattcagcatttgagcccctggtggccaacggagtccccgctgctttt
gtgcctaagcctggctctctgaagagaggtctcaattcccagagctcagatgaccactcg
aataagagatctcgcacctcttccatgagctccttgacgagcacatacacaggtggcatc
cctagctccagtcgcaatgccattactagttcttacagttctactcgaggtttctctcag
ttttggaagagaagtgggcccagctcatcaccattctctagcccagcctcatctcgctcc
cagacaccagagaggccagcaaagaaaatcagagaagatgagctttctcatcactccagt
tcttcgactccattggcagcagacaaggaggcccagggagaaaaagctgcagatacaacc
acgtcgaaggcacagaactcgtggagctccccgcccacacctggcagctctgggcagcgc
aagcggaagattcagttgctgccctcccggcgaggggcccggctgaccctgcccccacct
ccccagcttggctattctatcactgctgaagacctggatctggaaaaaagagcctcactg
cggtggtttaacaaggccttggcagatgggaccgatacttcctcgaattctgtcactgag
aagccccctaccactcagccttctctgacgttcaccccgcctgctgctgggaccaccacc
tccccagctaccctcccagccccaaacaccaacccgctgctcgagagcttgaagaagatg
cagagttctgctagcctgccatcttcttcggaatctgccggagtggcaaccactgtggcc
ccttcacctccgaagacacccagcctgctgccctctctcagctcttcacagtcaggggcc
cttccaggcgcctcctcggactccaagtccacagccactttctcggggctgacccctgct
gcgtccctgacgccagccaccgataccaccaagtcacctctggctcctcaggctgagaca
tctgccaaacctgcagccccgcccaccccatcccccacccccaagcagagtcttctgctg
ggaatgctgagcaccccgcctgctgacccccctgcgtcgacgccccccaccgtgtcatcc
gcgtcccccatgttcaagcccatcttcatggccccaccaaaaagtgagaatgagggcccc
ttgccatctagcccctcgaaggtcaccaccacgaccccttccagctctgccctccttgca
cccacgagcagccctcagcccgttttcaagcctatcttcggcaacatggggcccccgaca
tccacgcccttgtctgctgccttcttcagccagaccacggcttccgcaggcagagatgcg
agtacccctctcttccccagccaggccagtgccacctcaaccgtggctcctgtgagcgca
gccagcacttctatagactcagcttcaaagcccacgttcagctttggcgtgagcactgtg
accagcaccaccacctctgctgcccagcctttcctctttgggcccccccccacctccggg
gccagctttagcccagccataggctccatattccagttcggcaagccgcctgtggcaccc
gtgtcagacaacgtcaccacatttggccaatccgtccctggggctgtgcagacagccacc
agcagcagcagcagcagcagcagcagcagcagcgccagcgcctgcttcagtgggttcagt
ggcagcctcaccacccccgcccctgctaccagcagccagccagcgctgaccttcaccacc
accaccaccccagccttccacattccctttggctcaagcaccaagcccactctcccttca
tatccaggagccaatccccagcccacatttggggctaccgacgggcagcagcagggtgcc
actaagccaggcctagccccgagcttcggcagctctttcacttttgggaacacggcagct
gcggccccagccgcaaccccagcgcctggcccagcccagcccacctttggcagccctgca
caggctagttttggtggtttgaagcccactgcccctgccttcggcacccctgctaacacc
cagccagcctttggcagcaccacatctgtattctctttcggggcggcctccacctctggc
tttggagctacaacccagaccaccagcagcgggaccggtagctctatgtttggcagcaca
acactgtcacccttcacgtttgggggatcagctggcccagctagcagcgggggctttggg
atcaacgtggccacccctggcacctctggagcgttcagcttcggcacaggacaaagtggg
gctgctgccagcacgaccccttttggaggaggcttgagtcagagcacgttgggcgcacct
agtcagagcacaccttttgccttcaatgtggccagcacaccggagagcaaacccgtgttt
ggaggtacctccacacccagctttggtcagaacacccctgcccctggggtgggcgtgtca
ggcagtggtctctcctttggggcatcctcaacacccacccaaggctttgttggagttgga
cctttcggatcggcggccccttccttttccattggtgcaggatccaagaccccgggggct
cggcagcgactgcaggcccgccggcagcatacccgcaagaaatag

DBGET integrated database retrieval system