KEGG   Canis familiaris (dog): 489812Help
Entry
489812            CDS       T01007                                 

Gene name
POM121C, POM121
Definition
POM121 transmembrane nucleoporin C
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
cfa  Canis familiaris (dog)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    489812 (POM121C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 1204 aa AA seqDB search
MSPAAAAAGGGERRRPIASVRDGRGRGGGCGGPAGAVVLGLSLFGLVLYLVPAAAALAWL
AVGATAAWWGLSREPRGSRALSSLVRNARRQRPLHASPPAKSAVNGNLLESRTLLEGPDP
AELLLMGSYLGKPGPPQPAPAPEARDLLERPGRRRAPARAAPPAHSAHLVHHTHPSLPTP
LLRPPRRPSHRDCGTLSNRFVITPRRRYPIQQAQYSLLGVLPTVCWNGYHKKTVLSARNS
KMVCSPVTVRIAPPDSKWIRSPIPEQTINSTLSSPSSNAPDPCAKETVLSALKERKKRTV
EEEDQIFSDSQENKRRRHDSSGSGHSAFEPLVANGVPAAFVPKPGSLKRGLNSQSSDDHS
NKRSRTSSMSSLTSTYTGGIPSSSRNAITSSYSSTRGFSQFWKRSGPSSSPFSSPASSRS
QTPERPAKKIREDELSHHSSSSTPLAADKEAQGEKAADTTTSKAQNSWSSPPTPGSSGQR
KRKIQLLPSRRGARLTLPPPPQLGYSITAEDLDLEKRASLRWFNKALADGTDTSSNSVTE
KPPTTQPSLTFTPPAAGTTTSPATLPAPNTNPLLESLKKMQSSASLPSSSESAGVATTVA
PSPPKTPSLLPSLSSSQSGALPGASSDSKSTATFSGLTPAASLTPATDTTKSPLAPQAET
SAKPAAPPTPSPTPKQSLLLGMLSTPPADPPASTPPTVSSASPMFKPIFMAPPKSENEGP
LPSSPSKVTTTTPSSSALLAPTSSPQPVFKPIFGNMGPPTSTPLSAAFFSQTTASAGRDA
STPLFPSQASATSTVAPVSAASTSIDSASKPTFSFGVSTVTSTTTSAAQPFLFGPPPTSG
ASFSPAIGSIFQFGKPPVAPVSDNTSPHLANPSSSSSSSSSASACFSGFSGSLTTPAPAT
SSQPALTFTTTTTPAFHIPFGSSTKPTLPSYPGANPQPTFGATDGQQQGATKPGLAPSFG
SSFTFGNTAAAAPAATPAPGPAQPTFGSPAQASFGGLKPTAPAFGTPANTQPAFGSTTSV
FSFGAASTSGFGATTQTTSSGTGSSMFGSTTLSPFTFGGSAGPASSGGFGINVATPGTSG
AFSFGTGQSGAAASTTPFGGGLSQSTLGAPSQSTPFAFNVASTPESKPVFGGTSTPSFGQ
NTPAPGVGVSGSGLSFGASSTPTQGFVGVGPFGSAAPSFSIGAGSKTPGARQRLQARRQH
TRKK
NT seq 3615 nt NT seq  +upstreamnt  +downstreamnt
atgtctccggcggctgcggcggctggcggaggcgagcggcggcggccgatagcgagcgtc
agggacggccggggccggggagggggctgcggcggcccggccggggcggtggtcctcggc
ctgtcgctgttcggcctcgtgctgtacctggtgccggcggcggcggcgctggcctggctg
gccgtgggggccaccgcggcctggtggggactgagccgcgagccccgcggttcgcgcgcc
ctttcctctctcgttcggaacgcgcggcgtcagcggcccctgcacgcctcgcctccggct
aagtcggcggtgaacggaaacctcctagagtcgcggaccctgctcgaaggaccggacccc
gccgaactgctcctcatgggcagttacctgggcaagcccggccccccgcagcctgcaccc
gccccggaggccagggacctactggagaggcctggccgccgccgagcacccgctcgcgcc
gcgccgcctgcgcactcggcccatcttgtgcaccacactcacccctctctccccactcct
cttctccgaccccctaggaggccttcccaccgggattgtgggactttatcaaaccggttt
gtaataacacctcgaagacgatatccaatccagcaggcccaatattcccttctgggggta
cttcctacagtgtgctggaatggttatcacaagaagactgtgctatctgctcgtaattcc
aaaatggtgtgcagcccagtgacagtgaggattgctcctccagatagtaaatggattcgt
tcaccaataccagagcagacaatcaactcaacgctgtcctcaccatcaagtaatgcccca
gatccatgtgcaaaggagaccgtactgagtgccctcaaagagaggaagaaaaggacagtg
gaggaggaagatcaaatattttctgatagccaggaaaataaaagaaggcgccatgatagc
agcgggagtggacattcagcatttgagcccctggtggccaacggagtccccgctgctttt
gtgcctaagcctggctctctgaagagaggtctcaattcccagagctcagatgaccactcg
aataagagatctcgcacctcttccatgagctccttgacgagcacatacacaggtggcatc
cctagctccagtcgcaatgccattactagttcttacagttctactcgaggtttctctcag
ttttggaagagaagtgggcccagctcatcaccattctctagcccagcctcatctcgctcc
cagacaccagagaggccagcaaagaaaatcagagaagatgagctttctcatcactccagt
tcttcgactccattggcagcagacaaggaggcccagggagaaaaagctgcagatacaacc
acgtcgaaggcacagaactcgtggagctccccgcccacacctggcagctctgggcagcgc
aagcggaagattcagttgctgccctcccggcgaggggcccggctgaccctgcccccacct
ccccagcttggctattctatcactgctgaagacctggatctggaaaaaagagcctcactg
cggtggtttaacaaggccttggcagatgggaccgatacttcctcgaattctgtcactgag
aagccccctaccactcagccttctctgacgttcaccccgcctgctgctgggaccaccacc
tccccagctaccctcccagccccaaacaccaacccgctgctcgagagcttgaagaagatg
cagagttctgctagcctgccatcttcttcggaatctgccggagtggcaaccactgtggcc
ccttcacctccgaagacacccagcctgctgccctctctcagctcttcacagtcaggggcc
cttccaggcgcctcctcggactccaagtccacagccactttctcggggctgacccctgct
gcgtccctgacgccagccaccgataccaccaagtcacctctggctcctcaggctgagaca
tctgccaaacctgcagccccgcccaccccatcccccacccccaagcagagtcttctgctg
ggaatgctgagcaccccgcctgctgacccccctgcgtcgacgccccccaccgtgtcatcc
gcgtcccccatgttcaagcccatcttcatggccccaccaaaaagtgagaatgagggcccc
ttgccatctagcccctcgaaggtcaccaccacgaccccttccagctctgccctccttgca
cccacgagcagccctcagcccgttttcaagcctatcttcggcaacatggggcccccgaca
tccacgcccttgtctgctgccttcttcagccagaccacggcttccgcaggcagagatgcg
agtacccctctcttccccagccaggccagtgccacctcaaccgtggctcctgtgagcgca
gccagcacttctatagactcagcttcaaagcccacgttcagctttggcgtgagcactgtg
accagcaccaccacctctgctgcccagcctttcctctttgggcccccccccacctccggg
gccagctttagcccagccataggctccatattccagttcggcaagccgcctgtggcaccc
gtgtcagacaacacgtcaccacatttggccaatcccagcagcagcagcagcagcagcagc
agcgccagcgcctgcttcagtgggttcagtggcagcctcaccacccccgcccctgctacc
agcagccagccagcgctgaccttcaccaccaccaccaccccagccttccacattcccttt
ggctcaagcaccaagcccactctcccttcatatccaggagccaatccccagcccacattt
ggggctaccgacgggcagcagcagggtgccactaagccaggcctagccccgagcttcggc
agctctttcacttttgggaacacggcagctgcggccccagccgcaaccccagcgcctggc
ccagcccagcccacctttggcagccctgcacaggctagttttggtggtttgaagcccact
gcccctgccttcggcacccctgctaacacccagccagcctttggcagcaccacatctgta
ttctctttcggggcggcctccacctctggctttggagctacaacccagaccaccagcagc
gggaccggtagctctatgtttggcagcacaacactgtcacccttcacgtttgggggatca
gctggcccagctagcagcgggggctttgggatcaacgtggccacccctggcacctctgga
gcgttcagcttcggcacaggacaaagtggggctgctgccagcacgaccccttttggagga
ggcttgagtcagagcacgttgggcgcacctagtcagagcacaccttttgccttcaatgtg
gccagcacaccggagagcaaacccgtgtttggaggtacctccacacccagctttggtcag
aacacccctgcccctggggtgggcgtgtcaggcagtggtctctcctttggggcatcctca
acacccacccaaggctttgttggagttggacctttcggatcggcggccccttccttttcc
attggtgcaggatccaagaccccgggggctcggcagcgactgcaggcccgccggcagcat
acccgcaagaaatag

DBGET integrated database retrieval system