KEGG   Canis familiaris (dog): 489816Help
Entry
489816            CDS       T01007                                 

Gene name
POR, CPR, P450R
Definition
P450 (cytochrome) oxidoreductase (EC:1.6.2.4)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     489816 (POR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 678 aa AA seqDB search
MEDSSMDASATVSETVVEEVSLFSMTDMILFSLIVGLLTYWFLFRKKKDEIPEFTTIQPM
TSSAKDSSFVEKMKKTGRNIIVFYGSQTGTAEEFANRLSKDAHRYGMRGMAADPEEYDLA
DLGSLPEIENSLAVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKYAVFGLGNKTYEH
FNAMGKYVDKRLEQLGAQRIFELGMGDDDGNLEEDFITWREQFWPAVCEHFGVEATGEES
SIRQYELVVHTDIDMAKVYVGEMGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTERHL
MHLELDISDSKLRYESGDHVAVYPANDSALVNQLGEILGADLDVVMSLNNLDEESNKKHP
FPCPTSYRTALTYYLDITNPPRTNVLYELAQYASEPTEQEHLRKMASSSGEGKELYLSWV
VEARRHILAILQDYPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAVAVEYQT
RSGRINKGVATSWLRAKEPAGENGRRALVPMFVRKSQFRLPFKAATPVIMVGPGTGVAPF
IGFIQERAWLRQQGKEVGETLLYYGCRRSDEDYLYREELAQFHQDGSLTQLNVAFSREQP
HKVYVQHLLKRDKEHLWQLIHEAGAHIYVCGDARNMARDVQNTFYDIVAEVGAMEHAQAV
DYIKKLMTKGRYSLDVWS
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atggaggactccagtatggatgccagtgccaccgtgtctgaaactgtggttgaagaagtg
tctcttttcagcatgacagacatgattctgttttcactcattgtgggcctcctgacctac
tggttcctcttcagaaagaaaaaagacgaaatcccagagttcaccacaattcagccaatg
acttcttctgccaaagacagcagctttgtggaaaagatgaagaagacgggcaggaacatc
atcgtgttctacggctcccagacggggacagcggaggagtttgccaaccgcttgtccaag
gacgcccaccgctacgggatgcggggcatggctgcagaccccgaggaatatgacttggcc
gacctgggcagcctgccagagatcgagaactccctggcagtgttctgcatggccacttat
ggtgaaggggaccccacagacaatgcccaggacttctacgactggctccaggagaccgat
gtggacctctctggagtcaagtatgcggtgtttggccttgggaacaagacctacgagcac
ttcaatgccatgggcaagtacgtggacaagcggctggagcagctcggcgcccagcggatc
tttgagctggggatgggcgatgacgatggaaacctggaggaggacttcatcacgtggcga
gagcagttctggccggccgtatgcgaacacttcggggtggaagccaccggagaggagtcc
agcattcgccagtatgagcttgtggtccacacagacatagacatggccaaggtgtacgtg
ggagagatgggccgtctgaagagctacgagaaccagaaacccccctttgatgccaagaat
ccgttcttggccgcggtcaccaccaaccggaaactgaaccagggaacggagcgccatctc
atgcacctggaattagacatctcagactccaaactcaggtatgaatctggggaccatgtg
gccgtgtacccagccaatgactctgccctggtcaaccagcttggcgagatcctgggtgcc
gacctggacgtcgtcatgtccctgaacaaccttgacgaggagtccaacaagaagcacccc
ttcccctgccccacctcctaccgcacggccctcacctactacctggacatcaccaaccca
ccccgcaccaacgtgctctacgagctggcccagtacgcctctgagcccaccgagcaggag
cacctgcgcaagatggcctcctcctcgggcgagggcaaggagctgtacctgagctgggtg
gtggaggcccggaggcacatcctggccatcctgcaggactacccgtccctgcggcccccc
atcgaccacctgtgcgagctgctgccccggctccaggcccgctactactccatcgcctcg
tcctccaaggtccaccccaactccgtgcacatctgcgccgtggccgtggagtaccagacc
cggtccggccgcatcaacaagggcgtggccaccagctggctgcgcgccaaggagccagcc
ggggagaacgggcgccgggccctggtgcccatgttcgtgcgcaagtcccagttccgcctg
cccttcaaggcggccaccccggtcatcatggtggggcccggcacgggggtggccccattc
atcggctttatccaggagcgggcctggctgcggcagcagggcaaggaggtgggggagaca
ttgctctactacggctgccgccgctctgacgaggactacctgtaccgcgaggagctggcc
cagttccaccaggacggctccctcacccagctcaacgtggccttctcccgggagcagccc
cacaaggtctacgtgcagcacttactgaagagggacaaggagcatctgtggcagctgatc
cacgaggccggcgcccacatctatgtctgcggggacgctcggaacatggcgagggacgtg
cagaacaccttctacgacatcgtggccgaggtgggggccatggagcatgcccaggccgtg
gactacatcaagaagctgatgaccaagggccgctactccctggacgtgtggagctag

DBGET integrated database retrieval system