KEGG   Canis familiaris (dog): 489828Help
Entry
489828            CDS       T01007                                 

Gene name
ACHE
Definition
acetylcholinesterase
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
cfa  Canis familiaris (dog)
Pathway
Glycerophospholipid metabolism
Cholinergic synapse
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:cfa00564]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:cfa04725]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 645 aa AA seqDB search
MPPSLCRGQGCSFIGPLVLTEAVRVSRRLPALAAMRPPWCPLHTPSPASPILLLLLFLLG
GGAEAEDPELLVTVRGGRLRGIRLMAPGGPVSAFLGIPFAEPPVGPRRFLPPEPKRPWSG
VLDATAFQSVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLVWI
YGGGFYSGASSLDVYDGRFLAQAEGTVLVSMNYRVGAFGFLALPGSREAPGNVGLLDQRL
ALQWVQENVATFGGDPRAVTVFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWAT
VGVGEARRRATLLARLVGCPPGGAGGNDTELVACLRTRPAQDLVDHEWHVLPQESVFRFS
FVPVVDGDFLSDTPEALISAGDFHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAQ
FLAGVRVGVPQASDLAAEAVVLHYTDWLHPEDPARLREAMSDVVGDHNVVCPVAQLAGRL
AAQGARVYAYIFEHRSSTLTWPLWMGVPHGYEIEFIFGLPLEPSLNYTAEERTFAQRLMR
YWANFARTGDPNDPRDPKVPQWPPYTAGAQQYVSLNLRPLEVRRGLRAQACAFWNRFLPK
LLSATDTLDEAERQWKAEFHRWSSYMVHWKNQFDHYSKQDRCSDL
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgccaccctcgctgtgtcgtggccaaggatgttcatttattgggcccctggtcctgact
gaggctgtcagggtgtcccgacgcctgcctgccctggcagccatgaggcccccctggtgt
cccctgcacacgccctccccggcttccccaatccttctcctcctcctcttcctcttggga
ggaggggcagaggctgaggacccagagctgctggtaacagtgcgtgggggccggctgcgg
ggcatccgcctaatggcccccgggggccctgtctctgcttttctgggcatccccttcgca
gagccacctgtgggcccccgtcgctttctgccaccagagcccaagcggccctggtcaggg
gtgctggacgccacagccttccaaagcgtctgctaccaatatgtggacaccttataccct
ggctttgagggcactgagatgtggaaccccaaccgtgagctgagtgaagactgcctctac
ctcaatgtgtggacaccatacccccggcctgcatcacccacccctgtcctcgtatggatc
tatgggggtggcttctacagtggcgcctcctccctggacgtatatgatggccgcttcctg
gcccaggctgaggggaccgtgctggtgtccatgaactaccgggtgggagcctttggcttc
ttggccctgccagggagccgggaggccccaggcaacgtgggtctactggatcagaggctg
gcactgcagtgggtgcaggagaatgtggccaccttcgggggcgacccaagggcagtgact
gtgttcggggaaagcgctggtgcggcctcagtgggcatgcacctgctgtcccctcccagc
cggggcctgttccacagggctgtgctgcagagtggagcacccaacggcccttgggccaca
gtgggtgtgggagaggcccgccgcagggccacactgctggcacgcctggtgggctgtccc
ccagggggggccggtggcaatgacacagagctggtcgcctgcctgaggacacggccagct
caggacctggtggaccacgagtggcatgtgctgcctcaggaaagtgtcttccgcttctct
ttcgtgcctgtggtggatggtgacttcctcagtgacaccccggaggccctcatcagtgct
ggagacttccacgggctgcaggtgctggtgggtgtggtgaaggatgagggctcctatttt
ctggtttacggggccccaggcttcagcaaagacaacgaatctctcatcagccgggcccag
ttcctggctggggtgcgggtcggggtcccccaggcgagtgacctagctgccgaggctgtg
gtcctgcattacacagactggctgcaccctgaggacccggcacgcctgagagaggccatg
agtgatgtggtgggtgaccacaacgtcgtgtgccccgtggcccagctggctggacgcctg
gctgcccagggggctcgggtctatgcctacatctttgaacatcgctcgtccacgctcacc
tggcccctctggatgggggtgccccacggctacgagatcgagttcatctttgggctccct
ctggaaccctcgctaaactataccgctgaagagagaacctttgcccagcgactgatgaga
tactgggccaacttcgcccgcacaggggaccccaatgacccccgggaccccaaagtcccg
cagtggccaccgtacacggcgggagcgcagcagtacgtgagcttgaacctccggccgctg
gaggtgcgccgggggctgcgcgcccaagcctgcgccttctggaaccgcttcctacccaaa
ttgctcagcgccaccgacacgctggacgaggcggagcgccagtggaaggcggagttccac
cgctggagctcctacatggtgcactggaagaaccagtttgaccattacagcaagcaggat
cgctgctcagacctgtga

DBGET integrated database retrieval system