KEGG   Canis familiaris (dog): 489828Help
Entry
489828            CDS       T01007                                 

Gene name
ACHE
Definition
(RefSeq) acetylcholinesterase (Yt blood group)
  KO
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
cfa  Canis familiaris (dog)
Pathway
Glycerophospholipid metabolism
Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    489828 (ACHE)
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    489828 (ACHE)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     489828 (ACHE)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cfa00537]
 Enzymes
  489828 (ACHE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 611 aa AA seqDB search
MRPPWCPLHTPSPASPILLLLLFLLGGGAEAEDPELLVTVRGGRLRGIRLMAPGGPVSAF
LGIPFAEPPVGPRRFLPPEPKRPWSGVLDATAFQSVCYQYVDTLYPGFEGTEMWNPNREL
SEDCLYLNVWTPYPRPASPTPVLVWIYGGGFYSGASSLDVYDGRFLAQAEGTVLVSMNYR
VGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVATFGGDPRAVTVFGESAGAASVGMH
LLSPPSRGLFHRAVLQSGAPNGPWATVGVGEARRRATLLARLVGCPPGGAGGNDTELVAC
LRTRPAQDLVDHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALISAGDFHGLQVLVGVVK
DEGSYFLVYGAPGFSKDNESLISRAQFLAGVRVGVPQASDLAAEAVVLHYTDWLHPEDPA
RLREAMSDVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRSSTLTWPLWMGVPHGYEIE
FIFGLPLEPSLNYTAEERTFAQRLMRYWANFARTGDPNDPRDPKVPQWPPYTAGAQQYVS
LNLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKNQFD
HYSKQDRCSDL
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgaggcccccctggtgtcccctgcacacgccctccccggcttccccaatccttctcctc
ctcctcttcctcttgggaggaggggcagaggctgaggacccagagctgctggtaacagtg
cgtgggggccggctgcggggcatccgcctaatggcccccgggggccctgtctctgctttt
ctgggcatccccttcgcagagccacctgtgggcccccgtcgctttctgccaccagagccc
aagcggccctggtcaggggtgctggacgccacagccttccaaagcgtctgctaccaatat
gtggacaccttataccctggctttgagggcactgagatgtggaaccccaaccgtgagctg
agtgaagactgcctctacctcaatgtgtggacaccatacccccggcctgcatcacccacc
cctgtcctcgtatggatctatgggggtggcttctacagtggcgcctcctccctggacgta
tatgatggccgcttcctggcccaggctgaggggaccgtgctggtgtccatgaactaccgg
gtgggagcctttggcttcttggccctgccagggagccgggaggccccaggcaacgtgggt
ctactggatcagaggctggcactgcagtgggtgcaggagaatgtggccaccttcgggggc
gacccaagggcagtgactgtgttcggggaaagcgctggtgcggcctcagtgggcatgcac
ctgctgtcccctcccagccggggcctgttccacagggctgtgctgcagagtggagcaccc
aacggcccttgggccacagtgggtgtgggagaggcccgccgcagggccacactgctggca
cgcctggtgggctgtcccccagggggggccggtggcaatgacacagagctggtcgcctgc
ctgaggacacggccagctcaggacctggtggaccacgagtggcatgtgctgcctcaggaa
agtgtcttccgcttctctttcgtgcctgtggtggatggtgacttcctcagtgacaccccg
gaggccctcatcagtgctggagacttccacgggctgcaggtgctggtgggtgtggtgaag
gatgagggctcctattttctggtttacggggccccaggcttcagcaaagacaacgaatct
ctcatcagccgggcccagttcctggctggggtgcgggtcggggtcccccaggcgagtgac
ctagctgccgaggctgtggtcctgcattacacagactggctgcaccctgaggacccggca
cgcctgagagaggccatgagtgatgtggtgggtgaccacaacgtcgtgtgccccgtggcc
cagctggctggacgcctggctgcccagggggctcgggtctatgcctacatctttgaacat
cgctcgtccacgctcacctggcccctctggatgggggtgccccacggctacgagatcgag
ttcatctttgggctccctctggaaccctcgctaaactataccgctgaagagagaaccttt
gcccagcgactgatgagatactgggccaacttcgcccgcacaggggaccccaatgacccc
cgggaccccaaagtcccgcagtggccaccgtacacggcgggagcgcagcagtacgtgagc
ttgaacctccggccgctggaggtgcgccgggggctgcgcgcccaagcctgcgccttctgg
aaccgcttcctacccaaattgctcagcgccaccgacacgctggacgaggcggagcgccag
tggaaggcggagttccaccgctggagctcctacatggtgcactggaagaaccagtttgac
cattacagcaagcaggatcgctgctcagacctgtga

DBGET integrated database retrieval system