KEGG   Canis familiaris (dog): 489947Help
Entry
489947            CDS       T01007                                 

Gene name
PPP4C
Definition
protein phosphatase 4, catalytic subunit
Orthology
K15423  
serine/threonine-protein phosphatase 4 catalytic subunit [EC:3.1.3.16]
Organism
cfa  Canis familiaris (dog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 307 aa AA seqDB search
MAEISDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFY
DLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQI
TQVYGFYDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTI
DRKQEVPHDGPMCDLLWSDPEDTTGWGVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQL
VMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKK
PVADYFL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcggagatcagcgacctggaccggcagatcgagcaactgcggcgctgcgagctcatc
aaagagagcgaagtcaaggccctgtgcgctaaggccagagagatcttggtagaggagagc
aacgtacagagggtggactcgccagtcacagtatgcggtgacatccacggacaattctat
gacctcaaggagctgttcagagtgggtggcgacgtcccagagaccaactacctcttcatg
ggagactttgtggatcgtggtttctacagcgtcgaaacgttcctcctgctgctggcactg
aaggttcgctatcctgaccgcatcaccctgatccggggcaaccacgagagccgccagatc
acccaggtctatggcttctatgacgagtgtctgcgtaaatacggctcggtgactgtgtgg
cgctactgcacagagatctttgactacctcagcctgtcggccatcatcgatggcaagatc
ttttgtgtgcacgggggtctctccccctccatccagaccctggaccagatccggaccatt
gaccgaaagcaagaggtgccccatgacgggcccatgtgtgacctgctctggtctgaccct
gaagacacaacaggctggggtgtgagcccccgcggggctggctacctgtttggcagtgac
gtggtggcccagttcaatgcagccaacgacattgacatgatctgccgcgcccatcaactg
gtgatggaaggttacaagtggcacttcaatgagactgtgctcactgtgtggtctgcaccc
aactattgctaccgctgtgggaatgtggcagccatcttggagctggatgagcatctccag
aaagatttcatcatcttcgaggctgctccccaagagacccggggcatcccctccaagaag
cccgtggccgattatttcctgtga

DBGET integrated database retrieval system