KEGG   Canis familiaris (dog): 490189Help
Entry
490189            CDS       T01007                                 

Gene name
UOX
Definition
urate oxidase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
cfa  Canis familiaris (dog)
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    490189 (UOX)
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    490189 (UOX)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     490189 (UOX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
6
AA seq 304 aa AA seqDB search
MAHYHNDYKKNDEVEFVRTGYGKDMVKVLHIQRDGKYHSIKEVATSVQLTLSSKKDYVYG
DNSDIIPTDTIKNTVHVLAKFKGIKSIETFAMNICEHFLSSFNHVIRAQVYVEEVPWKRF
EKNGVKHVHAFIHNPTGTHFCEVEQMRSGPPVIHSGIKDLKVLKTTQSGFEGFIKDQFTT
LPEVKDRCFATKVYCKWRYHQGRDVDFEATWDTVRDIVLEKFAGPYDKGEYSPSVQKTLY
DIQVHSLSRVPEMEDMEISLPNIHYFNIDMSKMGLINKEEVLLPLDNPYGRITGTAKRKL
ASKL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcccattaccacaatgattataaaaagaacgatgaggtggagtttgtccgaactggc
tatgggaaggacatggtgaaagttctccacattcagcgagatggaaaataccacagcatt
aaagaggtggcaacttcagtgcaacttactctgagctccaaaaaagattacgtgtatgga
gataattcagacatcatccccacagacaccatcaagaacacagttcatgtcttggcaaag
tttaaagggatcaaaagcatagaaacttttgcaatgaacatctgtgagcatttcctttct
tcttttaaccatgtcatccgagctcaagtttatgtggaagaggtcccttggaagcgtttt
gaaaagaatggagttaagcatgtccatgcatttattcacaatcccactggaacacacttc
tgtgaggttgaacagatgagaagtggacctccagtcattcattctggaatcaaagatctc
aaggtcttgaaaacgacccagtctggattcgaaggattcatcaaggaccagttcaccacc
ctccctgaggtgaaggaccggtgttttgccaccaaagtgtactgcaaatggcgctatcac
cagggcagagacgtggactttgaggctacctgggatactgttcgggacattgtcctggag
aaatttgctggaccctatgacaagggcgagtactcaccctctgtccagaagaccctctat
gacatccaggtgcactctttgagtcgggttcctgagatggaagacatggaaatcagcctg
ccgaacattcactactttaacatagacatgtccaaaatgggactgatcaacaaagaagag
gtcttgctaccattagacaatccatatggcaggattactggtacggccaagaggaagctg
gcttcgaagctgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system