KEGG   Canis familiaris (dog): 490427Help
Entry
490427            CDS       T01007                                 

Gene name
CLK2
Definition
CDC-like kinase 2
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     490427 (CLK2)
Protein kinases [BR:cfa01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   490427 (CLK2)
Spliceosome [BR:cfa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    490427 (CLK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 500 aa AA seqDB search
MPHPRRYHSSERGSRGSYHEHYRSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSSYD
DRSSDRRVYDRRYYGSYRRNGCSRDRGEAYCDPDYRHSYEYHRENSSYRSQRSSRRKHRR
RRRRSRTFSRSSSQHSSRRAKSVEDDAEGHLIYHVGDWLQERYEIVSTLGEGTFGRVVQC
VDHRRGGARVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKNLCVQMFDWFDYHGHMC
ISFELLGLSTFDFLKDNNYLPYPIHQVRHMAFQLCQAVKFLHDNKLTHTDLKPENILFVN
SDYELTYNLEKKRDERSVKSTAVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQ
PCDVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPIPSRMIRKTRKQKYFYRGRLD
WDENTSAGRYVRENCKPLRRYLTSEAEEHHQLFDLIESMLEYEPAKRLTLGEALQHPFFA
RLRAEPPNTKLWDSSRDISR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcctcatccccgaaggtaccattcctcagagcgaggaagccggggcagttaccatgaa
cactatcggagccgaaagcataagagacgaagaagccgctcctggtcaagtagcagtgac
cggactcggcggcgccggcgggaagacagctaccatgtccgttcccggagcagttacgat
gatcgctcgtcagaccggagggtgtatgaccggcggtactatggcagctacaggcgcaat
ggctgtagccgagaccggggagaagcctactgtgacccagactaccggcactcctacgag
taccaccgggagaatagcagttaccgcagccagcgcagcagccggaggaagcacaggcgg
cggaggcggcgcagccggacattcagccgctcatcttcgcagcacagcagccggagagcc
aagagtgtagaggacgacgctgagggccacctcatctaccacgtcggggactggctacaa
gagcgatatgaaattgtaagcactttgggagaggggaccttcggccgagttgtacagtgt
gtcgaccatcgcaggggtggggcccgagttgccctgaagatcattaagaacgtggaaaag
tacaaggaagcagctcgacttgaaatcaatgttttagagaaaatcaacgagaaggaccct
gacaataagaacctctgtgtgcagatgtttgactggtttgactaccatggccacatgtgc
atctcttttgagcttctgggccttagcaccttcgatttcctcaaagacaacaactacctg
ccctaccccatccatcaagtgcgccacatggccttccagctgtgccaggctgtcaagttt
ctccatgataacaagctgacacatacggacctcaagcctgaaaatattctgtttgtgaat
tcggactatgagctcacctacaatttagagaagaaacgagatgaacgcagtgtgaagagc
acagctgtgcgggtggtggacttcggcagtgccacctttgaccacgaacatcacagtacc
attgtctccactcgccattatcgagcaccagaggtcattctcgagttgggctggtcacag
ccttgtgatgtgtggagcataggctgcatcatcttcgagtactacgtgggcttcacacta
ttccagacccatgacaacagagagcacctagccatgatggaaaggattttgggtcctatc
ccttcccggatgatccgaaagacaaggaagcagaaatatttttatcggggtcgcctggat
tgggatgagaacacatcggctgggcgctacgtacgagaaaactgcaaaccactgcggcgg
tatctgacctcagaggcagaggaacaccaccagctcttcgatctgattgaaagcatgcta
gaatatgaacctgctaagcggttgaccttgggtgaagcccttcagcatcctttcttcgcc
cgccttcgggctgagccacccaacaccaagttgtgggactccagtcgggatatcagtcgg
tga

DBGET integrated database retrieval system