KEGG   Canis familiaris (dog): 490924Help
Entry
490924            CDS       T01007                                 

Gene name
CDC27
Definition
cell division cycle 27
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
cfa  Canis familiaris (dog)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    490924 (CDC27)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    490924 (CDC27)
   04114 Oocyte meiosis
    490924 (CDC27)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    490924 (CDC27)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    490924 (CDC27)
Protein phosphatases and associated proteins [BR:cfa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     490924 (CDC27)
Ubiquitin system [BR:cfa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     490924 (CDC27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 824 aa AA seqDB search
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKLTSLQNFSNCL
PSSCTTLVSNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVI
SPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQN
YTNTSSVIDVPSTGAPSKKSVARIGQTGTKSVFSQSGNSREVTPILVAQTQSSGPQTSTT
PQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGIT
QPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAGLMSLLREMGKGYLALCSYN
CKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYS
TTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNY
AYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQK
ALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYK
SALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAID
KRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgctgcaggaacccgtccaggctgctatatggcaagcactaaaccactatgct
taccgagatgcagttttccttgcagaacgactgtatgcagaagtacactcagaggaagcc
ttgtttttattggcaacctgttattaccgctcaggaaaggcatataaagcatatagactc
ttgaaaggacacagttgtactacaccgcagtgtaaatacctgcttgcaaaatgttgtgtt
gatctcagcaagcttgcagaaggggaacagatcttatctggtggagtgtttaataagcag
aaaagccatgatgatattgttactgagtttggtgattcagcttgctttactctttcgttg
ttgggacatgtatattgcaagacagatcggcttgccaaaggatcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtccccctttgaatcattatgtgaaataggtgaa
aagccagatcctgaccaaacatttaaattaacatctttacagaactttagcaactgtctg
cccagctcatgtacaacactagtatctaatcatagtttatctcacagacagcctgagacc
gttcttacagaaacacctcaagacacaattgaattaaacagactgaatttagaatcgtcc
aattcaaagtactccttgaatacagattcctcagtgtcttacattgattcagctgtaatt
tcaccagatactgtccctcttggaacaggaacttccatattatctaaacaggttcaaaat
aaaccaaaaactggtcgaagcttattaggaggaccagctgctcttagcccattaacccca
agttttgggattttgccattagaaaccccaagtcctggagatggatcctatttacaaaac
tacactaatacatcttctgtaattgacgtgccatctactggagccccttcaaaaaagtct
gttgccagaatcggccaaactggaacaaaatctgtcttctcacagagtggaaatagtcga
gaggtaactccaattcttgttgcacaaacacaaagttctggcccacaaacaagtacaaca
cctcaggtattgagccccactatcacatctcccccaaacgcactgcctcgaagaagttca
cgactttttactagtgacagctctacaaccaaggagaatagcaaaaagttaaaaatgaag
tttccacctaaaatcccaaacagaaaaactaaaagtaaaactaataaaggaggaataact
caacctaacataaatgatagcctggaaattaccaaattggactcttccatcatttcagaa
gggaaaatctccacaatcacacctcagatccaggcatttaatctacagaaagcagcagca
ggtttgatgagccttcttcgtgaaatggggaaaggttatttagctttgtgttcttacaac
tgcaaagaagctataaatatcttgagccacctaccttctcaccactacaatactggttgg
gtactgtgccaaattggaagggcctattttgaactttcagagtacatgcaagctgaaaga
atattctcagaggttagaaggattgagaattatagagttgaaggcatggagatctactct
acaacactttggcatcttcaaaaagatgttgctctttcagttctttcaaaagacttaaca
gacatggataaaaattcaccagaggcctggtgtgctgcagggaactgtttcagtttgcaa
cgggaacatgatattgcgattaaattcttccagagagctatccaggttgatccaaattat
gcttatgcctatactctattagggcatgagtttgtattaactgaagaattagacaaagca
ttagcttgttttcgaaatgctatcagagtcaatccgagacattataatgcgtggtatggt
ttaggaatgatttattacaaacaagaaaaattcagccttgcagaaatgcatttccagaaa
gcacttgatatcaaccctcaaagttcagttttactttgccacattggagtagttcagcat
gcactgaaaaaatcagagaaggctttggataccctaaacaaagccattgttattgatccc
aagaaccctctatgcaaatttcacagagcctcagttttatttgcaaatgaaaaatataag
tctgctttacaagaacttgaagaattgaaacaaattgttcccaaagaatccctcgtttac
ttcttaataggaaaggtttacaagaagttaggtcaaacgcacctcgccctgatgaatttc
tcttgggctatggatttagatcctaaaggagccaataaccagattaaagaggcaattgat
aagcgctaccttccagatgatgaggagccaataacccaagaagaacagatcatgggaaca
gatgaatcccaggagagcagcatgacagatgcagacgacacacaacttcatgcagctgaa
agtgatgaattttaa

DBGET integrated database retrieval system