KEGG   Canis familiaris (dog): 490924Help
Entry
490924            CDS       T01007                                 

Gene name
CDC27
Definition
cell division cycle 27
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
cfa  Canis familiaris (dog)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Module
APC/C complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:cfa04120]
Cellular Processes; Cell growth and death; Cell cycle [PATH:cfa04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:cfa04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:cfa04914]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:cfa05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 824 aa AA seqDB search
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKLTSLQNFSNCL
PSSCTTLVSNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVI
SPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQN
YTNTSSVIDVPSTGAPSKKSVARIGQTGTKSVFSQSGNSREVTPILVAQTQSSGPQTSTT
PQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGIT
QPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAGLMSLLREMGKGYLALCSYN
CKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYS
TTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNY
AYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQK
ALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYK
SALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAID
KRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgctgcaggaacccgtccaggctgctatatggcaagcactaaaccactatgct
taccgagatgcagttttccttgcagaacgactgtatgcagaagtacactcagaggaagcc
ttgtttttattggcaacctgttattaccgctcaggaaaggcatataaagcatatagactc
ttgaaaggacacagttgtactacaccgcagtgtaaatacctgcttgcaaaatgttgtgtt
gatctcagcaagcttgcagaaggggaacagatcttatctggtggagtgtttaataagcag
aaaagccatgatgatattgttactgagtttggtgattcagcttgctttactctttcgttg
ttgggacatgtatattgcaagacagatcggcttgccaaaggatcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtccccctttgaatcattatgtgaaataggtgaa
aagccagatcctgaccaaacatttaaattaacatctttacagaactttagcaactgtctg
cccagctcatgtacaacactagtatctaatcatagtttatctcacagacagcctgagacc
gttcttacagaaacacctcaagacacaattgaattaaacagactgaatttagaatcgtcc
aattcaaagtactccttgaatacagattcctcagtgtcttacattgattcagctgtaatt
tcaccagatactgtccctcttggaacaggaacttccatattatctaaacaggttcaaaat
aaaccaaaaactggtcgaagcttattaggaggaccagctgctcttagcccattaacccca
agttttgggattttgccattagaaaccccaagtcctggagatggatcctatttacaaaac
tacactaatacatcttctgtaattgacgtgccatctactggagccccttcaaaaaagtct
gttgccagaatcggccaaactggaacaaaatctgtcttctcacagagtggaaatagtcga
gaggtaactccaattcttgttgcacaaacacaaagttctggcccacaaacaagtacaaca
cctcaggtattgagccccactatcacatctcccccaaacgcactgcctcgaagaagttca
cgactttttactagtgacagctctacaaccaaggagaatagcaaaaagttaaaaatgaag
tttccacctaaaatcccaaacagaaaaactaaaagtaaaactaataaaggaggaataact
caacctaacataaatgatagcctggaaattaccaaattggactcttccatcatttcagaa
gggaaaatctccacaatcacacctcagatccaggcatttaatctacagaaagcagcagca
ggtttgatgagccttcttcgtgaaatggggaaaggttatttagctttgtgttcttacaac
tgcaaagaagctataaatatcttgagccacctaccttctcaccactacaatactggttgg
gtactgtgccaaattggaagggcctattttgaactttcagagtacatgcaagctgaaaga
atattctcagaggttagaaggattgagaattatagagttgaaggcatggagatctactct
acaacactttggcatcttcaaaaagatgttgctctttcagttctttcaaaagacttaaca
gacatggataaaaattcaccagaggcctggtgtgctgcagggaactgtttcagtttgcaa
cgggaacatgatattgcgattaaattcttccagagagctatccaggttgatccaaattat
gcttatgcctatactctattagggcatgagtttgtattaactgaagaattagacaaagca
ttagcttgttttcgaaatgctatcagagtcaatccgagacattataatgcgtggtatggt
ttaggaatgatttattacaaacaagaaaaattcagccttgcagaaatgcatttccagaaa
gcacttgatatcaaccctcaaagttcagttttactttgccacattggagtagttcagcat
gcactgaaaaaatcagagaaggctttggataccctaaacaaagccattgttattgatccc
aagaaccctctatgcaaatttcacagagcctcagttttatttgcaaatgaaaaatataag
tctgctttacaagaacttgaagaattgaaacaaattgttcccaaagaatccctcgtttac
ttcttaataggaaaggtttacaagaagttaggtcaaacgcacctcgccctgatgaatttc
tcttgggctatggatttagatcctaaaggagccaataaccagattaaagaggcaattgat
aagcgctaccttccagatgatgaggagccaataacccaagaagaacagatcatgggaaca
gatgaatcccaggagagcagcatgacagatgcagacgacacacaacttcatgcagctgaa
agtgatgaattttaa

DBGET integrated database retrieval system