KEGG   Canis familiaris (dog): 490941Help
Entry
490941            CDS       T01007                                 

Gene name
HDAC5
Definition
histone deacetylase 5
Orthology
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
cfa  Canis familiaris (dog)
Pathway
Alcoholism
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    490941 (HDAC5)
  Substance dependence
   05034 Alcoholism
    490941 (HDAC5)
  Infectious diseases
   05169 Epstein-Barr virus infection
    490941 (HDAC5)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     490941 (HDAC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 1117 aa AA seqDB search
MNSPTESADGMSGREPSLEILPRTPLHGIPVAVEVKPVLPGAMPSSIGGGGGGSPSPAEL
RGALAGPVDPALREQQLQQELLALKQQQQLQKQLLFAEFQKQHDHLTRQHEVQLQKHLKQ
QQEMLAAKRQQELEQQRQQEQRRQEELEKQRLEQQLISLRNKEKSKESAIASTEVKLRLQ
EFLLSKSKEPTPGGLNHSLPQHPKCWGAHHASLDQSSPPQSGPPGTPPSYKLPLLGPYDS
RDDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGTVISTFKKRAVEITGAGPGVS
SVCNSAPGSGPSSPNSSHSTIAENGFTGSVPNIPTEMLPQHRALPLDSSPNQFSLYTSPS
LPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGALTGKFMSTSSIPGCLL
GVALEGDTSPHGHASLLQHVLLLEQARQQSTLIAVPLHGQSPLVTGERVATSMRTVGKLP
RHRPLSRTQSSPLPQSPQALQQLVMQQQHQQFLEKQKQQQLQLGKILTKTGELPRQPTTH
PEETEEELTEQQEALLGEGALTIPREGSTESESTQEDLEEEEEEEEEEEEEEEEECIQVK
DEEGESGAEEGPDLDESSAGYKKVFSDAQQLQPLQVYQAPLSLATVPHQALGRTQSSPAA
PGGMKSPPDQPAKHLFTTGVVYDTFMLKHQCMCGNTHVHPEHAGRIQSIWSRLQETGLLS
KCERIRGRKATLDEIQTVHSEYHTLLYGTSPLNRQKLDSKKLLGPISQKMYAMLPCGGIG
VDSDTVWNEMHSSSAVRMAVGCLVELAFKVAAGELKNGFAIIRPPGHHAEESTAMGFCFF
NSVAITTKLLQQKLNVGKVLIVDWDIHHGNGTQQAFYNDPSVLYISLHRYDNGNFFPGSG
APEEVGGGPGIGYNVNVAWTGGVDPPIGDVEYLTAFRTVVMPIAHEFSPDVVLVSAGFDA
VEGHLSPLGGYSVTARCFGHLTRQLMTLAGGRVVLALEGGHDLTAICDASEACVSALLSV
ELQPLDEAVLQQKPNINAVATLEKVIEIQSKHWSCVQRFAAGLGRSLREAQAGETEEAET
VSAMALLSVGAEQAQAAAAREHSPRPAEEPMEQEPAL
NT seq 3354 nt NT seq  +upstreamnt  +downstreamnt
atgaactctcccaccgagtcggcagatgggatgtcaggccgggaaccatccttggaaatc
ctgcctcggacccctctacacggcatccctgtggcagtggaggtgaagccggtgctgcct
ggagccatgcccagctccatagggggtgggggaggaggcagccccagccccgcggagcta
cggggggctctggcaggccctgtggaccccgcactgagggagcagcagctgcagcaggag
ctcctggcgctcaagcagcagcagcagctgcagaagcagctcctgttcgccgagttccag
aaacagcatgaccacctgacccggcagcacgaggtccagctgcagaagcacctcaagcag
cagcaggagatgctggcggccaaaaggcagcaggagctggagcagcagcggcagcaggag
cagcggcggcaggaggagctggagaagcagcggctggagcagcagctgatcagcctgcgg
aacaaggagaagagcaaagagagtgccatcgccagcaccgaggtgaagctgaggctccag
gaattccttctgtcgaagtcaaaggagcccacgcccggcggcctcaaccattccctccca
cagcaccccaaatgctggggagcccaccatgcttctttggaccagagttcccctccccag
agtggcccccctgggacgcctccttcctacaaactgcctttgcttgggccctacgacagc
cgcgatgacttccccctccgcaaaacagcctctgaacccaacttgaaagtacgttcgagg
ctaaagcagaaggtggctgagcggagaagtagtccccttttgcgccgcaaagatgggaca
gtcattagcacctttaagaagagagctgttgagatcaccggtgctgggcctggggtgtcc
tccgtgtgtaacagtgcaccaggctccggccccagctctcccaacagctcccacagcacc
attgctgagaatggctttactggctcagtccccaacatccccaccgagatgctcccccag
caccgggccctccctctggacagctcccccaaccagttcagcctctacacgtctccctct
ctgcccaacatctccctagggctgcaggccacagtcactgtcaccaactcacacctcacc
gcctccccgaagctgtccacgcagcaggaggccgagaggcaggccctccagtccctgcgg
cagggcggcgcactgacgggcaagttcatgagcacatcctccatccccggctgtctactg
ggcgtggcactggagggcgacactagcccccatgggcacgcctccctgctgcagcatgtg
ttgctgctggagcaggctcggcagcagagcaccctcattgctgtgccactccatgggcag
tccccgctggtgacaggtgaacgtgtggccaccagcatgcggacagtgggcaagctccca
cggcaccggcccttgagtcgtactcagtcctccccgctgccccagagcccccaggccctg
cagcagcttgtgatgcagcagcagcaccagcagttcctggagaaacagaagcaacagcag
ctgcagctgggcaagatcctcaccaagactggggagctgccacggcagcccaccacccac
cctgaggagacagaggaggagctgactgagcagcaggaggccttgcttggggagggagcc
ctgaccatcccccgagaaggctccacggagagtgagagcacgcaggaagacctggaggaa
gaggaggaggaagaagaggaggaggaggaagaggaggaggaggagtgcatccaggtcaag
gatgaggagggcgagagtggcgctgaggaggggcctgacttggatgagtccagtgctggt
tacaaaaaggtgttctccgatgcccagcagctgcagccacttcaggtgtaccaggccccc
ctcagcctggccactgtgccccaccaggccctgggccgcacccagtcctcacctgctgcc
cctgggggcatgaaaagccccccagaccagcccgccaagcacctcttcaccacaggtgtg
gtctacgacacgttcatgctgaagcaccagtgcatgtgtggaaacacacacgtgcaccct
gaacatgctggccggatccagagcatctggtcccggctgcaggagacaggcctgcttagc
aagtgtgagcggatccggggtcgcaaagccacgctggatgagatccagaccgtgcactcc
gaataccacaccctgctctatgggaccagccccctcaaccgacagaagctggacagcaag
aagctgctcggccccatcagccagaagatgtatgccatgctgccttgtgggggcattggg
gtggacagtgacaccgtgtggaatgagatgcactcctccagtgccgtgcgcatggcagtg
ggctgcctggtagagcttgctttcaaggtggccgcaggagagctcaagaatggatttgcc
atcatccggcccccgggacaccatgcagaggaatccacagccatgggattttgcttcttc
aactctgtagccatcacaaccaaactcctgcagcagaaactgaatgtgggcaaggttctc
atcgtggactgggacattcaccatggcaatggcacccagcaagcattttacaatgacccg
tctgtgctctacatctccctgcaccgctatgacaatgggaacttctttccaggctctggg
gctcctgaagaggttggcggagggccgggcattgggtacaatgtgaacgtggcatggacg
ggaggtgtggacccccccatcggagacgtggagtacctaacggccttcaggacagtggtg
atgcccattgcccacgagttctcacctgacgtggtcctggtttctgccgggtttgatgct
gttgagggacacctgtctccactgggtggctactctgtcaccgccagatgctttggccac
ttgaccaggcagctgatgacgctggcagggggccgggtggtgctggccctggagggaggc
cacgacttgaccgccatctgtgatgcctctgaggcctgtgtctcagctctgctcagcgtg
gagctgcagcccttggacgaggcagtcttgcaacaaaagcctaacatcaatgcagtggcc
acactagagaaagtcatcgagatccagagcaagcactggagctgcgtccagaggttcgct
gctggtctaggccgttccctgcgggaggcccaggcaggtgagacggaggaggcagagact
gtgagcgccatggccttgctgtcggtgggggcggagcaggcccaggctgctgctgcccgg
gagcatagccccaggccagcagaggagcccatggaacaggagcctgccctgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system