KEGG   Canis familiaris (dog): 490943Help
Entry
490943            CDS       T01007                                 

Gene name
NAGS
Definition
N-acetylglutamate synthase
Orthology
K11067  
N-acetylglutamate synthase [EC:2.3.1.1]
Organism
cfa  Canis familiaris (dog)
Pathway
Arginine and proline metabolism
Metabolic pathways
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    490943 (NAGS)
   01230 Biosynthesis of amino acids
    490943 (NAGS)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    490943 (NAGS)
Enzymes [BR:cfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     490943 (NAGS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 476 aa AA seqDB search
MATARLAWALRATSAGGRLRGPRSTGDARRLSGSARRRAARGASPGRRLSTAWAPAQPVR
EGTEGAEDDTHAPAAEEPEWTPPPAPPVPPEPLEPPGPPAGRSLVQRDIQAFLNQCGASP
GEARHWLTQFQTCYHSADKPFAVIEVDEEVLKCSRAVSSLAFALAFLQRMDMKPLVVLGL
PAPTAPSGCLSFWEAKAQLAQHCKVLVDELRHNAATAVPFFGGGSVLGAAEPAPHASYGG
IVSVETDLLQWCLESGSIPILCPIGETTARRSVLLDSLEVTAALAKALQPTKIIFLNTTG
GLHDGTQKVLSNVNLPADLDLVTNAEWVSTKERQQMRLIVDVLSRLPHHSSAVITSASTL
LTELFSNKGSGTLFKNAERMLRVRSLDSLDQGRLVSLVNASFGKKLRDDYLASLRPRLHS
VYVSEGYFKHSDGSFSNKQWIFFWFGLADIRDSYELVNHAKGLPDSFCKPASDPGS
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggcgcggttggcctgggccctgcgggccacctctgcgggaggaaggctgcgc
ggtccccgaagcaccggggacgcccggagactgagcggcagcgcacgacggcgggcggcc
aggggcgccagcccggggcgccggctcagcaccgcctgggcgcccgcccagccggtacga
gaagggaccgagggcgccgaggacgacacccacgcgcctgccgcggaggagccggagtgg
acgccgccccccgcgcccccggtcccccccgagcccctcgagccccccgggcccccggca
ggccgctcgctggtgcagcgggacatccaggcctttctgaaccagtgcggagccagcccc
ggggaggcgcgccactggctcacgcagttccagacctgctaccactccgcggacaagccc
ttcgccgtcatcgaggtggacgaggaggtactcaagtgcagtcgggccgtatccagcctg
gccttcgccctggcattcctgcagcgcatggacatgaagccactagtagtcctcgggctg
ccggctcccacagcgccctccggctgcctttccttctgggaggccaaggcacaacttgcc
cagcactgcaaggtgctggtggatgagctgcggcacaacgctgccactgccgtgcctttt
tttggtggtgggtcggtgctgggagctgctgagccagcccctcatgccagctatggtggc
atcgtctcagtggagaccgacctgctacagtggtgcctggagtcgggcagcattcccatc
ttgtgccccatcggggagacgaccgcacgccgttcggtgctcctcgactcgctggaggtg
accgcggctctagccaaggcgctgcagcctaccaaaatcatcttcctcaataccaccgga
ggcctgcacgatggcactcaaaaggtcctgagtaatgtgaacctgcccgctgatctggac
ctggtgaccaacgccgagtgggtgagcaccaaggaacggcagcagatgcggctcattgtg
gatgtgctcagccgcctgccccaccactcctcggccgtcatcacctccgccagcacgctg
ctcaccgagctcttcagcaacaaggggtccgggaccctgttcaagaacgccgagcggatg
ctgcgggtgcgaagcctagacagcctggaccagggccgcctagtgagcctggtcaacgcc
agcttcggcaagaagctccgggatgactacttggcttcgctgcgcccccggctgcactca
gtctacgtctctgaggggtacttcaaacacagtgatggcagcttctccaacaagcagtgg
atcttcttctggtttggtctggccgatatccgggactcttacgagctggtcaaccacgcc
aagggactgccggactccttctgcaagccagcttctgacccaggcagctga

DBGET integrated database retrieval system