KEGG   Canis familiaris (dog): 490971Help
Entry
490971            CDS       T01007                                 

Gene name
KAT2A, GCN5L2
Definition
K(lysine) acetyltransferase 2A
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
cfa  Canis familiaris (dog)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    490971 (KAT2A)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    490971 (KAT2A)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    490971 (KAT2A)
  Infectious diseases
   05166 HTLV-I infection
    490971 (KAT2A)
Enzymes [BR:cfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     490971 (KAT2A)
Transcription machinery [BR:cfa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     490971 (KAT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 904 aa AA seqDB search
MAQASLACLGPRGRTEKSGSQKRRERSWKTTTPIMLRRSDACALSAGCPCGPRARSAAPR
SAAGEAMAEPSQASTPAPATQPRPLQSPAPAPPPTPAPSPASAPTPAPTPAPAPAPVAAP
AGSTGTGGPGVGSGGTGSGGDPARPGLSQQQRASQRKAQVRGLPRAKKLEKLGVFSACKA
NETCKCNGWKNPKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLG
MVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMTRPVVEGSLGSPPFEKPNIEQG
VLNFVQYKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYKVNYTR
WLCYCHVPQSCDSLPRYETTHIFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILT
HFPKFLSMLEEEIYGANSPIWESGFTMPPSEGTQLVPRPATVSAAVVPSTPIFSPTMGGG
SNSSLSLDSGGADPMPAGEKRKLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAML
GPETSLLSANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPR
MPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTH
LMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMEC
ELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRE
TGWKPLGKEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPI
DLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGG
LIDK
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atggctcaggcttcacttgcttgtctggggccaagaggcaggacagaaaagtctggaagc
cagaaacggagggagcggtcgtggaagactacaactcccatcatgctccggcgcagcgac
gcctgcgcactgagcgccggttgcccatgcggccctagggctaggagcgccgcgccgcgc
tccgctgcgggggaggccatggcggaaccttcccaggcctcgaccccggctccggccacg
cagccccgtccccttcagtctccagcccctgccccacctccgactcctgcccccagcccg
gcttcagccccgactccggctcccactccggcaccagcccccgctccagttgcagcccca
gccggcagcacagggactgggggtcccggggtaggaagtggggggaccgggagcggaggg
gatccggctcgacctggcctgagccagcagcagcgcgccagccagaggaaggcgcaagtc
cgggggctgccgcgcgccaagaagcttgagaagctaggggtcttctcggcttgcaaggcc
aatgaaacctgcaagtgtaatggctggaaaaaccccaagccccccactgcaccccgcatg
gacctgcagcagccagctgccaacctgagcgagctgtgccgcagctgtgagcaccccttg
gctgaccacgtgtcccacctggagaatgtgtcagaagatgagattaaccggctgctgggt
atggtggtagacgtggagaacctgttcatgtctgttcacaaagaggaggacacggacact
aagcaggtctatttctacctcttcaagctcctgcggaaatgcatcctgcagatgacccgg
ccagtggtggagggctccctgggcagtcccccatttgagaagcctaatattgagcagggt
gtgctgaactttgtgcagtataagtttagtcacctggctcctcgggagcggcagacgatg
tttgaactctcaaagatgttcctgctctgccttaactactggaagcttgagactcctgcc
caatttcggcagcggtctcaggctgaggatgtggctacttacaaggtcaattataccaga
tggctctgctactgccacgtaccccagagctgtgacagcctcccccgctacgagaccact
cacatctttggacgaagccttctccgctccatcttcactgtgacccggcggcagctgcta
gagaagttccgggtggagaaggacaagctggtgcctgagaagaggacccttatcctcacc
cacttcccaaaattcctgtccatgctggaggaggagatatatggggcaaactctccaatc
tgggagtccggcttcaccatgccaccctcagaggggacccagctggtgcccaggccggct
acggtcagtgcagcagttgtccccagcacccccatcttcagtcctaccatgggtggaggc
agcaatagctccttgagtctggactctggaggggctgaccccatgccagcaggtgagaag
aggaagcttccggagaacctgaccctggaggatgccaagcggctccgtgtaatgggcgac
atccctatggagctggtcaacgaggtcatgctcaccatcactgaccctgctgccatgctg
gggcccgagacgagcctgctgtcagccaacgcagcccgggacgagacagctcgtctggag
gagcgccgaggcatcattgagttccacgtcatcggcaactcgctgacgcccaaggccaac
cggcgggtgttgctctggcttgtggggctgcagaatgtcttctcccaccagctgccacgt
atgcctaaggagtacatcgcccgcctcgtctttgacccgaagcacaagactctggcctta
atcaaggatgggcgggtcatcggtgggatctgcttccgcatgtttcccactcagggcttc
accgagattgtcttctgcgctgtcacctcaaatgagcaagtgaagggctacgggactcat
ctgatgaaccacttgaaggagtatcacatcaaacacaacattctctacttcctcacctat
gccgacgagtacgccattggctacttcaaaaagcagggcttctccaaggacatcaaggtg
cccaagagccgctacctgggttacattaaggactatgagggcgcaacattgatggagtgt
gagctgaatccccggattccctacacggagctgtcccatatcatcaaaaagcagaaggag
atcatcaagaagctgattgagcgcaaacaggcccagatccgaaaggtctaccccgggctc
agctgcttcaaggagggtgtgaggcagatccctgtggagagtgtccccggcattcgagag
acaggctggaagccactggggaaggagaaggggaaggagctgaaggatccagaccagctc
tacacaaccctcaaaaacttgctggcccagatcaagtcacaccccagtgcctggcccttc
atggagcctgtgaagaagtcggaggcccctgactactatgaggtcatccgcttccctatt
gacctgaagaccatgacagagcgactacgcagccgctactatgtcacccgcaagctcttt
gtggctgacctgcagcgtgtcattgccaactgccgcgagtacaaccccccagacagcgag
tactgccgctgcgccagcgccctggagaaattcttctacttcaagctcaaggagggtggg
ctcattgacaagtag

DBGET integrated database retrieval system