KEGG   Canis familiaris (dog): 491072Help
Entry
491072            CDS       T01007                                 

Gene name
KAT7
Definition
K(lysine) acetyltransferase 7
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
cfa  Canis familiaris (dog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 501 aa AA seqDB search
MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQDSSPVR
NLQSFGTEEPAYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQVVDFSDRGHLTGKH
ERHFSISGCPLYHNLSADECKAPTERQLRYKEKVAELRKKRNSGLSKEQKEKYMEHRQTY
GNTREPLLENLTSEYDLDLFRRAQARASEDLEKLRLQGQITEGSNMIKTIAFGRYELDTW
YHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRQKAKCVWKHPPGDEIYRKGSISVFEVD
GKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNY
NVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRY
LHNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAK
RSNSNKTMDPSCLKWTPPKGT
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgaaggaagaggaatgcaggcagtagttcagatggaaccgaagattccgatttt
tctacagatctcgagcacacagacagttcagagagtgatggcacatcccggcgatctgcc
cgagttacccgctcctcagcccggctgagccagagttcccaagattccagtcctgttcga
aatttgcaatcttttggcactgaggagcctgcttattctaccagaagagtgacccgtagt
cagcaacagcctaccccagtgactccgaaaaaatacccccttcgtcagactcgttcgtct
ggctcagaaacagagcaagtggttgacttttcagatagaggacatcttacaggaaagcat
gagagacatttctccatctcaggatgtccactctatcataacctctcagctgatgaatgc
aaggcaccaacagagaggcagctgcggtataaggaaaaggtggctgaactcaggaagaaa
aggaattctgggctgagcaaagagcagaaagagaaatatatggaacacagacagacctat
gggaacactcgggaacctctcttggaaaacctgactagcgagtatgacttggatcttttc
cgaagagcacaagcccgggcttcagaggatttggagaagttaaggctgcaaggccaaatc
actgaggggagcaacatgattaaaacaattgcttttggtcgttatgagctggacacttgg
taccattctccttatcccgaagaatatgcacgactgggacggctctacatgtgcgaattc
tgtttaaaatacatgaagagccaaacgatacttcgccgacaaaaggctaaatgtgtgtgg
aaacacccacctggcgatgagatctatcgcaaaggctccatctccgtgtttgaagtggat
ggcaagaaaaacaagatctactgccaaaatctgtgcctgttggccaagctttttctggac
cacaagacattatattatgatgtggaacccttcctgttttatgttatgactgaagcggac
aataccggctgtcacttgattggatatttttccaaggaaaagaattcattcctcaactac
aatgtgtcatgtatcctcaccatgcctcagtacatgagacagggctatggcaagatgctc
atcgatttcagttacttgctttccaaagtggaagaaaaagttggctccccggagcgtccc
ctctctgacctggggctcataagctatcgcagttactggaaagaagtgcttctccgttac
ctgcataatttccaaggcaaagagatttctatcaaagaaattagccaggagacagctgtg
aatcctgtggacattgtcagtactctgcaagcccttcagatgctcaagtactggaaagga
aaacatctagttctaaagagacaggacctgattgatgagtggatagccaaagaggccaaa
agatctaactccaataaaaccatggatccaagctgtttaaaatggacccctcccaagggc
acttaa

DBGET integrated database retrieval system