KEGG   Canis familiaris (dog): 491160Help
Entry
491160            CDS       T01007                                 

Gene name
NLK
Definition
nemo-like kinase
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
cfa  Canis familiaris (dog)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    491160 (NLK)
   04310 Wnt signaling pathway
    491160 (NLK)
   04068 FoxO signaling pathway
    491160 (NLK)
 Cellular Processes
  Cell communication
   04520 Adherens junction
    491160 (NLK)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     491160 (NLK)
Protein kinases [BR:cfa01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   491160 (NLK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 527 aa AA seqDB search
MSLCGARANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAA
VHPVQQHTSSAAAAAAAAAAAAAMLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAAT
VKAHHHQHSHHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDH
VKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQE
VVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTP
SLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKD
ALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPITNPKFDDTFEKNLSSVRQVKEI
IHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttgtggcgcaagagccaacgcaaaaatgatggcggcttataatggcggtaca
tctgcagcagcagcaggtcaccaccaccaccatcaccaccaccttccacacctccctcct
cctcaccttcaccaccaccaccaccctcaacaccatcttcatccggggtcggctgcggct
gtacaccccgtacagcagcatacctcttcggcagctgccgcagccgcagcagcggccgca
gctgcagccatgttaaaccctgggcaacaacagccatatttcccatcacccgcaccgggt
caggctcctggaccagctgcagcagccccagctcaggtacaggctgccgcagctgctaca
gttaaggcgcaccaccatcaacactcgcatcatccacaacagcagctggatattgagccg
gatagacctattggatatggagcctttggtgttgtctggtcagtaacagatccaagagat
ggaaagagagtagcactcaaaaagatgcccaacgtcttccagaatctggtctcttgcaaa
agggtcttccgggaattgaagatgttgtgtttttttaaacatgataatgtactctctgcc
cttgacatactccaacctccacacattgactattttgaagaaatatatgttgtcacagaa
ttgatgcagagtgacctacataaaattatcgtctctcctcaaccactcagctcagatcat
gtcaaagtttttctttatcagattttgcgaggtttgaaatatctccattcagctggcatt
ttacatcgagacattaagccagggaatctccttgtgaacagcaactgtgttctaaagatt
tgtgattttggattggccagagtggaggaattagatgaatcccgtcatatgactcaggaa
gttgttactcagtattatcgggctccagaaatcctgatgggcagtcgtcattacagcaat
gctattgacatctggtctgtcggatgtatctttgcagaactactaggacgaagaatactg
tttcaggcacaaagtcccattcagcagctggatttgattacggatcttttgggcacacca
tcgctggaagcaatgaggacagcttgtgaaggcgctaaggcgcacatactcaggggccct
cataaacagccatctcttcctgtactttataccctgtctagccaggctacacatgaagct
gttcatctcctttgcaggatgttggtctttgatccatccaaaagaatatccgctaaggat
gccttagcccacccctacctagatgaagggcgactacgatatcacacgtgtatgtgtaaa
tgttgcttttccacctctactggaagagtttataccagtgactttgagcccatcaccaat
cccaaatttgatgacacttttgagaagaacctcagttctgttcgacaggttaaagagatt
attcaccaattcattttggaacagcagaaaggaaacagagtgcctctctgcatcaacccg
cagtctgctgcttttaagagctttattagttccactgttgcccagccgtctgagatgccc
ccatctcctctggtgtgggagtga

DBGET integrated database retrieval system