KEGG   Canis familiaris (dog): 491241Help
Entry
491241            CDS       T01007                                 

Gene name
ENTPD2
Definition
ectonucleoside triphosphate diphosphohydrolase 2
Orthology
K01509  
adenosinetriphosphatase [EC:3.6.1.3]
Organism
cfa  Canis familiaris (dog)
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    491241 (ENTPD2)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     491241 (ENTPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 469 aa AA seqDB search
MAGKVLSLLPPLLLAAAGLAGLLLLCVPTRDVREPPALKYGIVLDAGSSHTSMFIYKWPA
DKKNDTGIVGQHSSCEVHGGGISSYADNPSRAGQSLVECLDQALQEVPRERHVGTPLYLG
ATAGMRLLKLTSPEASANVLAAVTQTLTQYPFDFRGAHILSGQDEGVFGWVTANYLLENF
IKITFEMAGPAEDPTNEVQLRLYGQHYRVYTHSFLCYGRDQVLLRLLAGALQTYGFHPCW
PRGYSSQVLLQDVYESPCTVAQRPQTFTGSTRVNLSGTSDPALCRGLILELFNFSSCHFS
QCSFNGIFQPPVAGNFIGFSAFFYTVDFLRTVMGLPVETLQQLEVAVVTICNQTWSELQA
RVPGEQARLPDYCAVATFVQQLLSQGYGFQEHTFRGVTFQKKAGDTTVGWALGYMLNLTN
LIPAEPPGMRKGTDLSAWVALVLLCTAILLAAAVLLLRRVRAAKLSSTI
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcggggaaggtgctgtcgctgctgccgccgttgctactggctgcggcgggcctcgcc
gggctcctgctgctgtgcgtccccacccgcgacgtccgggagccgcccgccctcaagtat
ggcattgtcctggacgctggctcttctcacacatccatgttcatctacaagtggcctgca
gacaaaaagaatgacacaggcatcgtgggccagcacagctcctgtgaggtgcacggaggg
ggcatctccagctacgcagacaacccttccagggctggccagagcctggttgaatgcttg
gaccaggcacttcaggaggttcccagagagagacatgtgggcacgcccctctacctggga
gccacagcaggcatgcgcctgctcaaactgaccagtccagaggcctcggccaatgtgctt
gcggctgtgacccagacgctgacccagtatccctttgatttccgtggtgcccacatcctc
tcgggccaggacgagggtgtgtttggttgggtgaccgccaactacctgctggagaacttc
atcaagatcaccttcgagatggccggcccagctgaggatcccaccaatgaggtccagctc
cggctctacggccagcactaccgtgtctacacccacagcttcctctgctatggccgtgac
caggtcctcctgaggctgctggctggtgcactacagacctatggcttccacccttgctgg
ccgaggggctattcgagccaagtgctccttcaagacgtgtatgagtctccgtgcactgtg
gcccagcggccccagaccttcactggcagcaccagggtcaacttgtcggggaccagcgac
cccgccctctgccgtggcctcatcttggagctcttcaatttctcctcctgccacttctcc
caatgctccttcaatggcatattccagccccctgtggctgggaacttcattggcttctct
gccttcttctacactgtggacttcctgaggaccgtgatggggctgcctgtggagaccctg
cagcagctagaagttgcggttgtcaccatctgcaaccagacatggagtgagctgcaggcc
cgggtccccggggagcaggcccgcctgcctgactactgcgcggtggccacattcgtgcaa
cagctgctgagccagggctatggcttccaggagcataccttccgtggggtaaccttccag
aagaaggccggggataccacggtgggctgggcgcttggctacatgctgaacctgaccaac
ctgatccccgccgagccaccgggaatgcgcaagggcacagacctcagcgcctgggtggcc
ctggtcctgctctgcactgccatcctgctggccgctgctgtcctgctgctgcgtcgggtg
cgcgctgccaagttgtccagtaccatctag

DBGET integrated database retrieval system