KEGG   Canis familiaris (dog): 491278Help
Entry
491278            CDS       T01007                                 

Gene name
RXRA, RXRalpha
Definition
retinoid X receptor, alpha
Orthology
K08524  
retinoid X receptor alpha
Organism
cfa  Canis familiaris (dog)
Pathway
PPAR signaling pathway
PI3K-Akt signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Bile secretion
Hepatitis C
Pathways in cancer
Transcriptional misregulation in cancer
Thyroid cancer
Small cell lung cancer
Non-small cell lung cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:cfa04151]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:cfa04920]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:cfa03320]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:cfa04919]
Organismal Systems; Digestive system; Bile secretion [PATH:cfa04976]
Human Diseases; Cancers; Pathways in cancer [PATH:cfa05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:cfa05202]
Human Diseases; Cancers; Thyroid cancer [PATH:cfa05216]
Human Diseases; Cancers; Small cell lung cancer [PATH:cfa05222]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:cfa05223]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:cfa04932]
Human Diseases; Infectious diseases; Hepatitis C [PATH:cfa05160]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 486 aa AA seqDB search
MGAEPGPHSEAAAEPGAVEKGALGDLRADFSTQVNSSSLNSPTGRGSMAAPSLHPSLGPG
IGSSLGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFGTGSPQLSS
PMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCK
GFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRN
ENEVESTSSANEDMPVEKILEAELAVEPKTETYVDANMGLNPNSPNDPVTNICQAADKQL
FTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNS
AHSAGVGAIFDRVLTELVSKMRDMQMDKSELGCLRAIVLFNPDSKGLSNPAEVEALREKV
YASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLE
APHQMT
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgggggctgagcctgggccacacagtgaggcagccgctgagccaggggccgtggagaag
ggggcattgggagacctgcgcgctgacttctccacccaggtgaactcctcatccctcaac
tcccccacggggcgtggctccatggccgccccctcgctgcacccctctctggggcctggc
atcggctcctcgcttggctccccgggacagctgcactcgcccatcagcacgctgagctcc
cccatcaacggcatgggcccacccttctcggtcatcagctcccccatgggcccccactcc
atgtcggtgcctaccacgcccaccctgggcttcggcaccggcagcccccagctcagctcc
cccatgaaccccgtcagcagcagcgaggacatcaagccgccgctgggcctcaatggtgtc
ctcaaggtcccggcccacccctcagggaacatggcgtccttcaccaagcacatctgtgcc
atctgtggggaccgctcctcaggcaagcactacggagtgtatagctgtgagggctgcaag
ggcttcttcaagcggacggtgcgcaaggacctgacctacacctgccgcgacaacaaggac
tgcctgatcgacaagcggcagcgcaaccgctgccagtactgccgctaccagaagtgcctg
gccatgggcatgaagcgggaagccgtgcaggaggagcggcagcggggcaaggaccggaac
gagaatgaggtggaatccacgagcagcgccaacgaggacatgccagtggagaagattctg
gaggcggagctggctgtggagcccaagactgagacgtacgtggacgcgaacatggggctg
aaccccaattcgcccaacgaccccgtcaccaacatctgccaggctgcggacaagcagctc
ttcactctggtcgagtgggccaagcggatcccgcatttctctgagctgcccctggacgac
caggtcatcctgctcagggcaggctggaatgagctgctcatcgcctccttctcccaccgg
tccatcgccgtgaaggacgggatccttctggccaccggactgcacgtccaccggaacagt
gcccacagcgcgggggtgggcgccatcttcgacagggtgctgacagagctcgtgtccaag
atgcgggacatgcagatggacaagtcggagctgggctgcctgcgtgccattgtcctcttc
aacccggactccaaggggctctcgaacccggcagaggtggaggcactgcgggagaaggtc
tacgcgtccctggaggcgtattgcaaacataagtaccccgagcagccaggaaggtttgcc
aagctgctgctccgcctgccggccctgcgctctattggcctcaagtgcctggaacatctc
ttcttcttcaaactcatcggagacacgcccatcgacaccttcctcatggagatgctggaa
gccccccaccagatgacttag

DBGET integrated database retrieval system