KEGG   Canis familiaris (dog): 491290Help
Entry
491290            CDS       T01007                                 

Gene name
LAMC3
Definition
(RefSeq) laminin, gamma 3
  KO
K06247  
laminin, gamma 3
Organism
cfa  Canis familiaris (dog)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    491290 (LAMC3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    491290 (LAMC3)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    491290 (LAMC3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    491290 (LAMC3)
   05222 Small cell lung cancer
    491290 (LAMC3)
  Infectious diseases
   05146 Amoebiasis
    491290 (LAMC3)
   05145 Toxoplasmosis
    491290 (LAMC3)
Cell adhesion molecules and their ligands [BR:cfa04516]
 1. Immunoglobulin Superfamily
  Others
   LU; Lutheran blood group glycoprotein [KO:K06578]
    Laminin-14 Extracellular matrix (ECM) components
     491290 (LAMC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 1479 aa AA seqDB search
MALGVQHPTSVNITLRLGKAYEITYVRLKFHTSRPESFAIYKRTRAGGPWEPYQYYSASC
QKTYGRPEGQYLRPGDDERVAFCTSEFSDISPLSGGNVAFSTLEGRPSAYNFEESPVLQE
WVTSTELLISLDRLNTFGDDIFKDPKVLQSYYYAVSDFSVGGRCKCNGHASECSPDGAGR
LACRCQHNTTGTDCERCLPFFQDRPWGRGTAEAANECVPCNCSGHSEECVFDRELFRSTG
HGGRCLRCRDHTAGPHCERCQEDFYRWSPRTPCQPCDCHPAGSLRLQCDASGTCICKPTV
TGWKCDRCLPGFHSLSEGGCRPCSCSHAGSLGTCDPHSGRCPCKENVEGHVCDRCRPGTF
NLQPHNPAGCTSCFCYGHSKVCEAAAQFREHHIISDLRQGAKGWRTGSVGGPEHPAQWGP
RGLLLNPEDEEELTLPEKFLGDQRFSYGQPLTLTFLVPPGASPLPVQLRLEGAGLALTLQ
HSSLSSSLDAEQPGEVQLRFELQETSEDVDPPLPPFHFQRLLTNLTALRIRTSGQSPSPS
GQVFLTEVRLTSAQRGLSPTASWVETCSCPKGYTGQFCESCAPGYKREIPLGGPYTNCVP
CTCNQHGTCDPHTGICVCDHHTEGPSCERCLPGFYGNPFAGQPDDCQPCPCPGQSACIAV
PESSDVVCTHCPLGQRGRRCEICDDGYFGDPLGISGAPEPCRPCQCSGNVDPNAVGNCDS
QSGHCLRCLHNTTGAHCERCQDGFYGSALAPRPADRCTPCNCHPEGSVSEQRPCDPVTGQ
CTCLPHVMGRDCDRCSPSFYDLQPGRGCRSCKCHPLGSQEDQCHPKTGQCPCRPGVEGQA
CDRCQLGFFGFSIKGCRACRCSPLGAASPQCHKNSTCVCRPGFVGYKCDHCQDNFFLTAG
GTHCQECPSCYSLVKEEAAKLKARLTLMEGWLEGTNCGRSWGPLPILQGEAPRGDIYQDY
HLLQGAWEVFLEQVTGLKDAVKAAREQLRALSRGASCAQAQTEKTCIQLADLDTVLESSE
EEILQAATVLKSLVIPQNGPSQPTTWSHLATEARALARSHKDATAKIKATARRALVASNT
SYALLWSLVEGRMALEAQRELEDRYQDVQAAQKALGTAAAEVLPEAEKALATVQRVGVDA
APRLALLAAPMALVLPEPAISLQPQKSQAGALDLKVQALEKTVTSRERVVTEAAWALQAT
AQAMLHKTQPLMQLRQEARAALTRASSSVQAATVTVMGARTLLADLEGMKRQFPQPKDPA
TLGRKAGSVRGRLLTDLKKKTKQAERMLGNAASVSASAKKKGQEAETLAKDSAKLAKALL
REGKQEHRRAGRLSSQVQTTLRQASQQVLASGDRRQELEAAGQVGASLNAVEQQIWESRT
SLEKDVKVLSELLARLGSLDTHQAPVQALNETQWALERLRLQLSPPGALQGKLRLLEQES
EQQELQIQSFENDLAEIRADKQNLEAILQSLPKSCASWQ
NT seq 4440 nt NT seq  +upstreamnt  +downstreamnt
atggccctgggcgtgcagcaccccacctcggtcaacatcacgctccgcctggggaaagct
tatgagatcacctacgtgaggctgaagttccacaccagccgccccgagagctttgccatc
tacaagcgcacacgtgctggcggcccatgggagccctaccagtactacagtgcctcctgc
cagaagacctacggcaggcccgagggacagtacctgcgccctggtgatgacgagcgggtg
gccttctgcacctcggagttcagtgacatctccccactgagcggtggcaacgtggccttc
tccaccctggagggccggcccagcgcttacaacttcgaggagagccctgtgttgcaggag
tgggtcaccagcactgagctcctcatctccctggatcggctcaacacatttggggatgac
atcttcaaggacccaaaggtgctgcagtcctactactatgctgtgtccgacttctctgtg
ggtggcagatgcaagtgcaacgggcatgccagcgagtgcagtcccgatggggcaggccgg
ctggcctgccggtgccagcacaacaccacgggtacagactgcgagcgctgcctgcccttc
ttccaggaccgcccgtggggccggggcacagccgaggctgccaacgagtgtgtgccctgc
aactgcagcggccactccgaggagtgtgtgttcgaccgggagctcttccgcagcacgggg
catggtgggcgctgcctccgctgccgggaccacacggctgggccgcactgcgagcgctgc
caggaggacttctatcgctggagcccacggacgccctgccagccctgtgactgccaccca
gcaggctccctgcgcctccagtgtgatgcctcaggtacctgcatctgcaagcccactgtg
acgggttggaagtgtgaccgctgcctgcctgggttccactcactcagtgagggaggctgc
agaccctgttcctgtagtcatgctggcagcctgggcacctgtgacccccacagtggacgc
tgcccctgcaaagagaatgtggaaggccatgtgtgtgacagatgtcgtccaggaacattc
aacctacagccacacaacccagccggctgcaccagctgcttctgctatggccactccaag
gtgtgtgaggctgctgcccagtttcgggagcaccacatcatctctgacctccgccaggga
gccaagggctggcggaccggaagtgtggggggcccagaacatcctgcacaatggggccca
agggggctcctcctgaatcccgaagatgaggaggagctcacgctaccagagaagttcctg
ggagatcagcggttcagctatggacagcccctcaccctgaccttcttggtgccccctggg
gcctccccgcttcctgtgcagctgaggctggaaggggctggcctggccctgactctgcag
cactccagcctctccagctccctggatgctgagcagcctggggaggtacagctcaggttc
gagctgcaggagacctccgaagatgtggaccctcccctgcctcccttccacttccagcgg
ctgctcaccaatctgacggctctgcgcatcaggaccagtggccagagcccaagcccttcc
ggccaggtgttcctgactgaggttcggctcacatcggcccagcgggggctctcccccaca
gcctcctgggtggagacctgctcatgtcccaaggggtacacaggccagttctgtgaatcc
tgtgctccaggatacaagagggagataccactggggggtccctacaccaattgtgtcccc
tgcacctgcaaccagcatggcacctgtgacccccacacagggatctgcgtgtgcgaccac
cacacggagggtccatcctgtgagcgctgcttgccaggtttctatggcaaccccttcgca
ggccaacctgatgactgccagccctgtccatgccctggacagtcggcctgcatagccgtc
ccagagagcagcgacgtggtgtgtacccactgccccctcggccagagagggcggcgctgt
gagatctgtgatgatggctactttggggatcccctggggatctctggggctcccgagccg
tgccggccgtgccagtgcagtgggaacgtggaccccaacgctgtgggcaactgcgactcc
cagtctggccactgcctgcgttgcctgcacaatacaacaggtgcccactgtgagcgctgt
caggacggcttctacgggagcgccctggcccctcggcctgcagacagatgcaccccctgc
aactgccaccctgagggctcagtcagcgagcagagaccctgcgacccagtgaccggccag
tgtacctgcttgcctcatgtgatgggacgggactgtgaccgctgcagccccagcttctat
gacctccagcctgggaggggctgccggagctgcaagtgtcacccgctgggctcccaggag
gaccagtgccaccccaagactgggcagtgcccctgtcgcccgggtgttgagggccaggcc
tgcgacagatgccagctgggtttcttcggcttctccatcaagggctgccgggcctgtagg
tgctccccgttgggtgctgcctcaccccagtgccacaagaacagcacgtgcgtgtgcagg
cccggcttcgtaggctacaagtgtgaccactgtcaggacaacttcttcctcacggctggc
ggcacacactgtcaggagtgcccatcctgctactccctggtgaaggaggaggctgccaag
ctgaaggccaggctgaccctgatggaggggtggctggaggggaccaattgtggcaggtcc
tggggaccactgcccattctgcagggagaggccccacggggggacatctaccaggactac
cacctcctgcaaggagcctgggaagtcttcctggagcaggtgacaggcctcaaggatgct
gtgaaggctgcccgggagcagctgcgggctctgagcagaggtgccagctgtgcccaggcc
caaacagagaagacctgcatccagctggcagaccttgacacagtgttggagtcctcagaa
gaggagattctgcaggcggccactgtcctcaagtccctggtgattcctcagaatggaccc
agccagcccaccacctggagccacctcgccacagaggcccgtgctcttgccagaagccac
aaggacgccactgccaagatcaaggccactgctcggagggctctagttgcttccaacacc
agttacgcccttctctggagtctagtagagggcagaatggccttggaggcccagcgggaa
ctagaggacaggtaccaggatgtccaggcggcccagaaggcgctgggcacagccgcggca
gaggtgctgcctgaagcggagaaggcgctggccaccgtgcagcgagtcggtgtagacgca
gccccgcgcctggccttgctggctgcacccatggcactggtcctgcctgagcctgccatc
tccctgcagccccagaagtcccaggctggggccctggacctgaaagttcaggccttggag
aagacggtcacatccagagagcgggtggtcaccgaggctgcctgggccctccaggccact
gcccaggctatgctgcacaagacccagcccctcatgcagctacgccaggaggccagagct
gccctgacccgggcttcctcgtctgtccaggccgccacagtgactgtcatgggagccagg
accctgctggctgatctggaaggaatgaagcggcagtttcctcagcccaaggacccggcc
acgctggggaggaaggcaggctcggtcaggggcaggcttctcacagacttgaaaaagaag
accaagcaggcagagaggatgctgggaaatgcagcgtctgtctccgccagtgccaagaag
aagggccaggaagccgagacgttggccaaggacagtgctaagctcgccaaggccttgctc
agggagggcaagcaggagcaccggcgggcaggccggctctccagccaggtgcagacaacg
ctccgacaggcttcccagcaggtgctagcttcaggggaccgcagacaggagctggaggca
gctgggcaggtgggtgccagcctgaatgccgtggagcagcagatctgggaatcacggacc
tccctggagaaggacgtcaaggtcttgtcggagctgctcgccaggctggggtcactggac
acccatcaagccccagtgcaggccctgaacgagacccagtgggcactggagcgcctgagg
ctgcagttgagccctccaggggccctgcaggggaagctgaggctgttggagcaggagtct
gagcagcaggagctgcagatccagagcttcgagaacgaccttgctgagatccgtgctgac
aagcagaacctggaggccattctgcagagcctgcccaagagctgtgccagctggcagtga

DBGET integrated database retrieval system