KEGG   Canis familiaris (dog): 491396Help
Entry
491396            CDS       T01007                                 

Gene name
H2BFWT
Definition
(RefSeq) H2B histone family, member W, testis-specific
  KO
K11252  
histone H2B
Organism
cfa  Canis familiaris (dog)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    491396 (H2BFWT)
  Immune diseases
   05322 Systemic lupus erythematosus
    491396 (H2BFWT)
  Substance dependence
   05034 Alcoholism
    491396 (H2BFWT)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   491396 (H2BFWT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 205 aa AA seqDB search
MIPGKPEEGKGSSEGPICDTEVACDVRKCSDYKGASAPQQPPLSVLLSCWEGEPHMAEPG
CETSSEECLGTKEPREAEPETPKRKKPRRQCHRRCRRSRSDSFAIYFPRVLKQVDEGLSL
SQKAVSIMDSFVKDIFERIADEASRLARSTKRSTITSREIQTAVRLLLPGEIGKYAVSEA
TKALMRNQVGALEKQVKNVLSLGCG
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatacctggaaagccagaggagggcaaaggatcttcagagggacccatctgtgataca
gaggttgcctgtgacgtcaggaaatgcagcgactataaaggggccagtgcccctcagcag
ccgccattgtccgtccttctgagctgttgggagggtgagccccacatggctgagcctggc
tgtgagacctcttcggaggaatgcctgggcactaaagagcccagggaagccgaaccagag
accccgaagaggaagaagccaaggcgtcaatgccaccgtcgctgccggcgcagccgctca
gacagtttcgccatctacttccccagggttctgaagcaggttgacgagggtctgagcctc
tcacagaaggctgtgagcatcatggattcgttcgttaaggacatcttcgagcgcatcgct
gacgaggcctctcgcctggcccgctccaccaagcgctccaccatcacctccagggagatc
cagaccgccgtacgcctgctgctgccgggggagattggcaagtacgcggtgtctgaggcc
accaaggccctcatgagaaatcaagtgggagcactagaaaaacaagttaaaaatgtacta
tccctgggctgtggatga

DBGET integrated database retrieval system