KEGG   Canis familiaris (dog): 491690Help
Entry
491690            CDS       T01007                                 

Gene name
MAPK4
Definition
mitogen-activated protein kinase 4
Orthology
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
cfa  Canis familiaris (dog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 584 aa AA seqDB search
MAEKGDCIASVYGYDLGGRFVDFQPLGFGVNGLVLSAVDSRARRKVAVKKIILSDARSMK
HALREIKIIRRLDHDNIVKVYEVLGPQGADLQGELFKLSVAYIVQEYMETDLARLLEQGT
LTEEHAKLFMYQLLRGLKYIHSANVLHRDLKPANIFISTEDLVLKIGDFGLARIVDQHYS
HKGYLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCILAEMLTGRMLFAGAHELEQMQL
ILETIPVIREEDKDELLRVMPSFISSTWEVKRPLRKLLPEVNSEAIDFLEKILTFNPMDR
LTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDDILLMAANQSQLSNWDRYPVSLSSD
LEWRPDRGQDASEVQRDPRAGSGSAALAEDVQVDPRKDSQGSSERFLERSPSSMERAFEA
DCGRSCDYKVGSPSYLDKLLWRDSKPHHYSEPKLILDLSHWKQAAGPPPSARVAADPGPR
EDEPASLFLEIAQWVQSTRGGPEPASPAPGSPERRPAASPPSRAAPEDGASPQFDLDVFI
SRALKLCTKPEDLPDSKLGDLNGACIPEHPGDLVQTEAFSKERW
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaagggggactgcatcgccagtgtctacgggtacgaccttggtggccgcttt
gttgacttccagcccctgggctttggcgtcaacgggctggtgctatcggccgtggacagc
agggcccgccggaaggtggccgtgaagaagatcatcctgagtgatgcccgcagcatgaag
cacgcgctccgagagatcaagatcatccggcgcctggaccacgacaacatcgtgaaggtg
tacgaggtgctgggaccccagggtgcggacctgcagggcgagctgttcaagctcagcgtg
gcctacatcgtccaggagtacatggagaccgacctggcacggctgctggagcagggcacg
ctgacagaggagcacgccaagctgttcatgtaccagctgctccgcggcctcaagtacatc
cactcggccaatgtgttgcacagggacctgaagcccgccaacatcttcatcagcacagag
gaccttgtgctcaagattggggacttcgggttggctcgcatcgttgaccagcattattca
cacaagggttatctgtcggaagggctggtaactaagtggtaccgctcaccccgcctgctc
ctgtcccctaacaactacaccaaagccatcgacatgtgggccgccggctgcatcctggcc
gagatgctcacgggcagaatgctctttgctggggctcacgagctggagcagatgcagctg
atcctagagaccatccctgtgatccgggaggaggacaaagacgagctgctcagggtgatg
ccgtccttcatcagcagcacctgggaagtgaagcggccgctgcgcaagctgctccctgaa
gtgaacagtgaagccatagactttctagagaagatcctgaccttcaaccccatggatcgc
ctaacagcagagatggggctgcagcacccctacatgagcccatactcgtgccctgaggat
gagcccacctcgcagcaccccttccgcattgaagacgagatcgatgacatcctgctgatg
gccgccaaccagagccagctctccaactgggacaggtaccccgtgagcctgtcatccgac
ctggagtggaggccggaccgcggccaggacgccagcgaggtgcagcgcgacccccgcgcg
ggctcgggctcggcggcgctggcggaggacgtgcaggtggacccgcgcaaggactcgcag
ggcagctcggagcgcttcctggagcgctcgccctcgtccatggagcgcgccttcgaggcc
gactgcgggcgctcctgcgactacaaggtgggctcgccctcctacctggacaagctgctg
tggcgcgacagcaagccacaccactactcggagcccaagctcatcctggacctgtcgcac
tggaagcaggcggccgggccgccccccagcgccagggtggccgcggaccccgggccgcgc
gaggacgagccggccagcctcttcctggagatcgcgcagtgggtgcagagcacgcggggc
ggccccgagcctgccagcccggcccccggcagccccgagcgccgccccgccgcctccccg
cccagccgcgcggccccggaggacggcgccagcccccagttcgacctggacgtgttcatc
tcccgcgccctgaagctctgcaccaagccggaggacctgcccgacagcaagctgggtgac
ctgaacggcgcgtgcatccccgagcaccccggcgacctggtgcagaccgaggccttctcc
aaagaaaggtggtga

DBGET integrated database retrieval system