KEGG   Canis familiaris (dog): 492116Help
Entry
492116            CDS       T01007                                 

Gene name
UROS
Definition
uroporphyrinogen III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cfa  Canis familiaris (dog)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    492116 (UROS)
Enzymes [BR:cfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     492116 (UROS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
28
AA seq 264 aa AA seqDB search
MKVLLLKDPKEDDCGQDPYIRELGLYGFEATLIPVLSFEFLSLPSFSEKLSHPEGYGGLI
FTSPRAVEAVELCLEKDNKTEVWKHSLKEKWNAKTVYVVGNATASLVNKIGLDAEGANCG
NAEKLAEYICSRESPALPLLFPCGTVKGEILPQMLKDRGIPMESITVYQKVPHPGIQVNL
NSYYAKQGIPASITFFSPSGLAYSLKHIQELSGDNIDRIKFAAIGPSTARALAAQGLPVS
CTAESPTPQGLATGLRLALEAPRC
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttcttttactgaaagaccctaaagaggatgactgtggccaagatccatacatc
agggaattaggattatatggatttgaagccactctgatccctgttttatcatttgagttt
ttgtctcttcccagtttttctgagaagctgtctcatcccgaaggctatgggggactcatt
tttaccagccccagagcagtggaagcagtggagctgtgtttggagaaagacaataaaact
gaagtctggaagcattctctgaaagaaaaatggaacgctaagacagtgtatgtggttgga
aatgctactgcttctctagtgaataaaatcggcctagatgcagaaggagcaaactgtgga
aatgcagaaaagcttgcagaatacatttgttcccgggagtcaccagcattgcctcttctg
tttccctgtggaaccgtcaaaggagaaatcctgccccagatgctcaaggacagagggatt
cccatggaaagcatcactgtctatcagaaggtcccacacccgggaatccaagtgaacctc
aacagctactatgctaagcagggcatcccggccagcatcacatttttcagtccctctggc
cttgcgtacagcctcaagcatattcaggagttatctggtgacaacattgatcgaattaag
ttcgccgccatcggccccagcacggcccgcgcactggccgcccagggcctgcccgtgagc
tgcacggctgagagccccacgccgcagggcctggccacgggcctccgcttggcactggag
gccccgcgctgctga

DBGET integrated database retrieval system