KEGG   Canis familiaris (dog): 492143Help
Entry
492143            CDS       T01007                                 

Gene name
USP26
Definition
ubiquitin specific peptidase 26
Orthology
K11850  
ubiquitin carboxyl-terminal hydrolase 26/29/37 [EC:3.1.2.15]
Organism
cfa  Canis familiaris (dog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
X
AA seq 924 aa AA seqDB search
MATLMVHGFVQIWSKKKGMSSSREAYIETVEGKKKIRLVVYFTNGEYLTFQLSNNIKNVV
LRSYGKKQNHLHLTFQNNNFLFIERLSSKDAKELKMFLDKVHQNNTQPSMRPVKDGGIFA
SMTTPKEINKNSFHRACKKPGSGSFETREGSGTPDLQKMPLFTSKSSRLSWKDLPESGDG
KKKKMLSSGSEMSGKIQSNSVRKKKSQTNPLRYVSHDEKKKLRLKLLKKNQKLEFEPLLK
SISPGEPYLDGKSLLQMLSEKIYLTFLLEPRYNADDPEWDKLKMTFNFYPEKLWQGLPNL
GNTCYMNAVLQSLFSIPSFADDLFSQDFPWGKIPLDALRMCLAQLFVLKNIYNIKIKERL
LVNIKKAISTVAEIFSGNIQNDAHEFLGHFLDQMKENMGKINTLWKMKIESEQDNSAQQV
FAGSATTRVLICPIITNFEFELLRSIICQACGQVILKTEVSNYLSINLPRGMKALPLSIQ
SAFDLFFGAEELEYRCEKCQHRSSVAVHKFSRLPRVLIVHLKRYIFNEFWSLRKDDQEVV
ISKYLKLSSHCNESTKPPFPVSKNAHNRDFQILKLFQKMSAGTICPSAASSKLASASSDS
PVPHAGPDKGSEPQKCQIFYDGSSRVQQKKDLGKSSEQNITESKLLNLGNGALIEKELFA
AGLMMDLEAVSPSLIHDKDGKPTSSPEIRLAEAYLQEASENLKQKKYDKTDMFVDFESVA
KILEDFFEGKKPRISKKTEFQKAAERRQQHEAMRIYEQALQQALLQILLKPDAQWYMQNL
RRPTNLGPQQARVNSQGASCSTKNPGNKKVLDTEKTEIKAKKSKRNAKVNDRYAYRLIGV
VSHLGKTPNSGHYISDAYDFERQVWFTYNDLQVSSIQEALMQEARLCTGYIFFYMHNEIF
EELLKREENSQSPSTETGEIPQEK
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atggctactctaatggtacatggttttgttcaaatatggagcaagaagaaggggatgtct
agctccagagaagcatacattgaaacagtggaaggaaagaagaagattagactggtggtc
tatttcaccaatggagaatatctaacttttcagctaagtaataatattaaaaatgtggtc
cttagatcctatggaaaaaagcaaaatcacctgcacttaactttccaaaataataacttc
ttgtttattgaaagattatcttccaaagatgctaaagagttgaagatgttcctggataaa
gtccatcaaaataatactcagccatccatgagacctgttaaggatggaggtatctttgcc
agcatgacaacaccaaaggaaattaacaaaaactccttccacagagcgtgcaagaagcca
ggtagtggatcttttgagacaagagaaggaagtggaacacctgaccttcagaagatgcct
ttgtttacatcaaagtcatcaagacttagttggaaagatttaccagagagtggagatggg
aagaagaaaaagatgctatcatctggctcagagatgagtgggaaaatacagagtaactct
gtaagaaagaagaaatcccagacaaaccccttgaggtatgtaagtcatgacgagaagaaa
aaactgaggttaaaacttttaaaaaagaatcagaaattagaatttgagcccttactcaag
tccatttctcctggagagccttacctagatggcaaaagtcttcttcagatgctctctgag
aaaatatatttgacatttctgttggaaccaaggtataatgcagatgacccagagtgggac
aaactcaagatgaccttcaacttctacccagagaaactatggcaaggcctccccaatttg
ggaaacacctgttacatgaatgctgttttacagtctttattttccattccatcatttgct
gatgatttattcagccaggatttcccgtggggtaaaattccccttgatgctcttaggatg
tgcttggcacaactgtttgttttgaaaaatatttataacataaaaatcaaggagaggtta
cttgtaaatattaaaaaggccatttcaacagttgcagagatattctctggcaatatacaa
aatgatgctcatgagtttttaggtcactttttggatcagatgaaagagaacatggggaaa
ataaacacactttggaaaatgaaaattgaatctgagcaggacaattcagctcaacaggtc
tttgctggcagtgctaccaccagagtactcatttgtcccatcatcactaattttgagttt
gagttgctgcgctctattatttgtcaagcatgtggtcaggtaattttgaagacggaagtg
agtaattatctatccatcaatctaccccggggaatgaaagcacttcctttgtctattcag
tcagcctttgatctcttctttggagcagaagaacttgagtacagatgtgagaaatgtcag
cacaggagttctgttgcagtgcacaaattcagtaggctccccagggttcttattgttcac
ctgaaacgttatatcttcaacgagttttggtcgctaaggaaggatgatcaggaagttgtt
atttccaagtatctaaagttatcatctcattgtaatgaaagtacgaaaccaccttttccc
gtgagcaagaatgcgcataatagggacttccaaatcctaaaactctttcagaagatgagt
gctggcaccatctgtccatcagcagcttcatcaaagttggcctcggcatccagtgattcc
ccagttccgcatgctggaccagacaaagggtccgaaccacagaaatgccagattttctat
gacgggtccagcagagtacaacagaaaaaggacctgggcaaaagctctgaacagaatata
acagagtccaaattgctgaacttaggaaatggagcactcattgaaaaagagctatttgct
gctggcttaatgatggatctggaagcagtgtccccttctctgatccatgacaaagatggt
aaacccaccagtagtccagaaatacgccttgctgaagcctatcttcaagaagcatctgaa
aatctaaagcaaaagaaatacgacaaaactgacatgtttgtagattttgagagtgttgct
aagatccttgaagacttttttgaaggtaaaaaacccagaatttcaaaaaaaacagaattc
caaaaagcagctgaacggagacagcagcatgaagcaatgaggatctacgaacaagccctt
cagcaggcactgcttcagatccttttgaagccagatgctcagtggtacatgcagaacctc
aggagacccacaaacctaggtccccagcaggccagagtaaattcccaaggtgcatcgtgt
tccactaaaaaccctggaaacaagaaagttttagatacggagaagacagaaattaaagcc
aagaaatcaaaaagaaatgcgaaggtgaatgatcgctatgcctatcggctcattggtgtt
gtcagccatctggggaagaccccaaattcaggccattatatcagtgatgcctatgacttt
gagaggcaagtgtggttcacatacaatgatctccaggtatcaagtatccaagaagctctg
atgcaggaggccagactttgcaccgggtacatcttcttttacatgcacaatgagatattc
gaagagctgttgaaaagggaagagaactcccagtctccgagcacagaaacaggggagatc
cctcaggagaaataa

DBGET integrated database retrieval system