KEGG   Canis familiaris (dog): 494003Help
Entry
494003            CDS       T01007                                 

Gene name
CYP19A1, CYP19
Definition
cytochrome P450, family 17, subfamily A, polypeptide 1 (EC:1.14.14.14)
Orthology
K07434  
aromatase [EC:1.14.14.14]
Organism
cfa  Canis familiaris (dog)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Ovarian steroidogenesis
Module
C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    494003 (CYP19A1)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    494003 (CYP19A1)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.14  aromatase
     494003 (CYP19A1)
Cytochrome P450 [BR:cfa00199]
 Cytochrome P450, animal type
  CYP19 family
   494003 (CYP19A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
30
AA seq 503 aa AA seqDB search
MLLEMLNPMHYNITSMMPEVMPVATMPILLLTGFLLLVWNYEDTSSIPGPGYCMGIGPLI
SHCRFLWMGIGSACNYYNKMYGEFMRVWICGEETLIISKSSSMFHIMKHSHYSSRFGSKL
GLQCIGMHENGIIFNNNPTLWKAIRPFFTKALSGPGLVRMVTVCVGSIITHLDRLEEVSN
ELGYVDVLTLMRRIMLDTSNILFLGIPLDESAIVVKIQGYFDAWQALLLKPDIFFKISWL
YKKYEKSVKDLKDAMEILIEEKRHRISTAEKLEDHMDFATELIFAEKRGDLTRENVNQCI
LEMLIAAPDTMSVSVFFMLFLIAKHPKVEESIMKEIQAVVGERDIRIDDMQKLKVVENFI
YESMRYQPVVNLVMRKALQDDIIDGYLVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAK
NVPYRYFQPFGFGPRSCAGKYIAMVMMKVVLVTLLRRFHVQTLQGECIENMQKKYGLSLH
PDETNNLLEMVFVPRNSEKCLER
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgcttttggaaatgctgaacccaatgcattacaacatcaccagcatgatgcccgaagtc
atgcctgtggccaccatgccaatcctgctgctcacaggttttcttcttttggtttggaat
tatgaagacacatcctcaataccaggtcctggctattgtatgggaattgggcccctaatt
tcccactgcaggttcctatggatggggattggcagtgcttgcaactactacaacaagatg
tacggagaattcatgagagtctggatatgtggagaggaaacactcattattagcaagtcc
tctagcatgttccacataatgaagcacagtcactacagctcccgatttggcagcaaactt
ggattgcagtgcattggcatgcatgaaaacggcatcatatttaacaacaatccaacactc
tggaaagctattcgacccttctttacaaaagctctgtctggccccggcctcgtgcgtatg
gtaacagtttgtgttggatccatcataacgcatctggacaggttggaggaagtcagcaac
gaactgggttatgtcgacgtgttgactctcatgcggcgcatcatgctggacacctctaac
attctcttcctggggatccccttggacgaaagtgccattgtggttaaaatccagggttat
tttgatgcgtggcaagctctccttctcaaaccagacatcttctttaagatttcttggcta
tacaaaaagtatgaaaagtctgtcaaggatttaaaagatgccatggaaattctgatagaa
gaaaaaagacacagaatttccacagcagagaaactggaagaccatatggattttgccact
gaattgatttttgctgagaaacgtggtgacttaacaagagagaatgtgaaccagtgcata
ctggaaatgctgatcgcagcaccagacaccatgtctgtctctgtgttctttatgctattt
ctcattgcaaagcaccctaaggttgaagaatcaataatgaaggagatccaggctgttgta
ggtgagagagacataaggattgatgatatgcaaaaattaaaagtggtggaaaactttatc
tacgagagcatgcggtaccagcctgttgtgaacttggtcatgcgcaaagccttacaggat
gatatcattgatggctacctagtgaaaaaggggactaacattatcctgaatattggaaga
atgcatagactggagtttttccccaagcccaatgaatttactcttgaaaactttgcaaag
aatgttccttacaggtattttcagccatttggctttggacctcgtagctgtgcaggaaag
tacattgccatggtgatgatgaaagttgtcctggttacacttctgagacgtttccacgtg
cagacattgcaaggagagtgtattgaaaatatgcagaaaaaatatggcttgtccttacac
ccggatgagactaacaacttgctggaaatggtttttgtcccaagaaattcagaaaagtgc
ctcgagcgctaa

DBGET integrated database retrieval system