KEGG   Canis familiaris (dog): 494010Help
Entry
494010            CDS       T01007                                 

Gene name
CYP1A2, CYPIA2, DAH2
Definition
(RefSeq) cytochrome P450, family 1, subfamily A, polypeptide 2
  KO
K07409  cytochrome P450 family 1 subfamily A polypeptide 2 [EC:1.14.14.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00140  Steroid hormone biosynthesis
cfa00232  Caffeine metabolism
cfa00380  Tryptophan metabolism
cfa00591  Linoleic acid metabolism
cfa00830  Retinol metabolism
cfa00980  Metabolism of xenobiotics by cytochrome P450
cfa00982  Drug metabolism - cytochrome P450
cfa01100  Metabolic pathways
cfa05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    494010 (CYP1A2)
   00591 Linoleic acid metabolism
    494010 (CYP1A2)
  Amino acid metabolism
   00380 Tryptophan metabolism
    494010 (CYP1A2)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    494010 (CYP1A2)
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    494010 (CYP1A2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    494010 (CYP1A2)
   00982 Drug metabolism - cytochrome P450
    494010 (CYP1A2)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    494010 (CYP1A2)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     494010 (CYP1A2)
Cytochrome P450 [BR:cfa00199]
 Cytochrome P450, animal type
  CYP1 family
   494010 (CYP1A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 Sec8_exocyst
Motif
Other DBs
NCBI-GeneID: 494010
NCBI-ProteinID: NP_001008720
Ensembl: ENSCAFG00000017941
UniProt: Q5R2U2
Position
30
AA seq 512 aa AA seqDB search
MALSQMATELLLASTIFCLVLWVVKAWQPRLPKGLKSPPGPWGWPLLGNVLTLGKSPHLA
LSRLSQRYGDVLQIRIGSTPVLVLSGLDTIRQALVRQGDDFKGRPDLYSFSLVTDGQSLT
FSPDSGPVWAARRRLAQNALNTFSIASDPASSCSCYLEEHVSKEAEALLSRLQEQMAEVG
RFDPYNQVLMSVANVIGAMCFGHHFSQRSEEMLPLLMSSSDFVETVSNGNPVDFFPILQY
MPNSALQRFKNFNQTFVQSLQKIVQEHYQDFDERSVQDITGALLKHNEKSSRASDGHIPQ
EKIVNLINDIFGAGFDTVTTAISWSLMYLVANPEIQRKIQKELDTVIGRARQPRLSDRPQ
LPLMEAFILEIFRHTSFVPFTIPHSTTKDTTLKGFYIPKECCVFINQWQVNHDQQVWGDP
FAFRPERFLTADGTAINKTLSEKVMLFGMGKRRCIGEVLAKWEIFLFLAILLQRLEFSVP
AGVRVDLTPIYGLTMKHTRCEHVQARPRFSIK
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggcattgtcccagatggccacagagcttctcctggcctccaccatcttctgcttggta
ctctgggtggtcaaggcctggcagcctcggcttcccaaaggcctgaagagtccaccgggg
ccctggggctggcccctgctcgggaacgtgctgaccttgggcaagagcccccacctggcg
ctgtccaggctgagccagcgttatggggacgtgctgcagatccgcatcggctccaccccc
gtgctggtgctcagtggcctggacaccatccggcaggccctggtgcgccagggggatgat
ttcaagggccggcccgacctctacagcttctctctggtgaccgacggccaaagcctgacc
ttcagcccagactccggaccagtgtgggctgcgcgcaggcgcctggctcagaacgcgctc
aacaccttctccattgcctccgacccggcttcctcgtgctcttgctacctggaagagcat
gtgagcaaggaggccgaggcccttctcagcaggctgcaggagcagatggcagaggttggg
cgctttgatccctacaaccaagtgctgatgtcagtggccaatgtcattggtgcaatgtgc
tttgggcaccacttctctcagagaagtgaggaaatgctccccctcctaatgagctccagt
gattttgtggagaccgtctccaacgggaacccggtggactttttccccattctccaatat
atgcccaactcagccctgcagagattcaagaacttcaaccagacgttcgtgcagtccctg
cagaaaattgtccaggaacactatcaagactttgatgagcgcagtgtccaggacatcaca
ggcgccctcttgaagcacaatgagaagagctccagggctagtgatggccacatcccccaa
gagaagattgtcaaccttatcaacgacatttttggggccggatttgacactgtcacaacg
gccatttcctggagtcttatgtaccttgtggcaaaccctgagatacagagaaagatccag
aaggagttggacacggtgattggcagggcacggcagcctcgcctctctgacaggccccag
ctgcccttaatggaggccttcatcctggagatcttccgacacacctcctttgtccccttc
accatcccccacagcacaacaaaggacacaaccttaaagggcttctacatccccaaggaa
tgctgtgtcttcataaaccagtggcaggtcaatcatgaccaacaggtgtggggggatcca
tttgcattccggccagagcgattcctcactgcagatggcaccgccatcaacaagaccttg
agtgagaaggtgatgctctttggcatgggcaagcgccggtgcataggagaggtcctggcc
aagtgggagatcttcctcttcctagccatcttgctgcagcggctggagttcagcgtgcca
gcaggtgtgagagtagacctaacccccatctatgggctgaccatgaagcacacccgctgt
gagcatgtccaggcacggccacgcttctccatcaagtga

DBGET integrated database retrieval system