KEGG   Canis familiaris (dog): 606490Help
Entry
606490            CDS       T01007                                 

Gene name
GCK
Definition
glucokinase (hexokinase 4)
Orthology
K12407  
glucokinase [EC:2.7.1.2]
Organism
cfa  Canis familiaris (dog)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Butirosin and neomycin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Insulin secretion
Prolactin signaling pathway
Type II diabetes mellitus
Maturity onset diabetes of the young
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    606490 (GCK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    606490 (GCK)
   00052 Galactose metabolism
    606490 (GCK)
   00500 Starch and sucrose metabolism
    606490 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    606490 (GCK)
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    606490 (GCK)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    606490 (GCK)
   04910 Insulin signaling pathway
    606490 (GCK)
   04917 Prolactin signaling pathway
    606490 (GCK)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    606490 (GCK)
   04950 Maturity onset diabetes of the young
    606490 (GCK)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     606490 (GCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 303 aa AA seqDB search
MLDDRARMDVTKKEKAEQILADFQMQEADLKKVMRRMQREMARGLRLETHEEASVKMLPT
YVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWSVKTKHEMYSIPEDAMTGTAE
MLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNN
IVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRRCEVGMIVGTGCNACYXEEMQN
VELVEGTRPGRQREAGQPVAHHVYSPRPPALLCSTEQRVVHWTPEAAPKGTVVATASAHG
SGV
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgacagagccaggatggacgtcaccaagaaggaaaaggcagagcagatcctg
gcggacttccagatgcaggaggcggacttgaagaaggtgatgcggcggatgcagagggag
atggcgcggggcctgcggctggagacccacgaggaggccagcgtgaagatgctgcccacc
tacgtgcgctccaccccagaaggctcagaagtcggggacttcctctccctggacctgggc
ggcaccaacttcagggtgatgctggtcaaggtgggggagggcgaggaggggcagtggagt
gtgaaaaccaagcacgagatgtattccatccctgaagatgccatgactggtactgctgag
atgctctttgactacatctccgagtgcatctccgatttcctggacaagcatcagatgaag
cacaagaagctgcccttgggcttcaccttctcctttcctgtgaggcatgaagacatcgac
aagggcatcctcctcaattggaccaagggcttcaaagcatcaggagcagaggggaacaac
atcgtggggctcctccgtgacgccatcaaacgcagaggggactttgaaatggacgtggta
gcaatggtgaacgacacggtggccacgatgatctcttgctactatgaagaccgccggtgt
gaggttggcatgattgtgggcacaggctgtaacgcctgctacnatgaggagatgcagaac
gtggagctggtggaagggacgaggccgggccggcagagggaggctgggcagccagtggcc
catcacgtttattctccaaggcccccagcccttctctgctccacagagcagagggtagtg
cactggactccagaagcagcacccaaaggtactgttgtggccacggccagtgcccatggg
tctggggtgtag

DBGET integrated database retrieval system