KEGG   Canis familiaris (dog): 606765Help
Entry
606765            CDS       T01007                                 

Gene name
ACR
Definition
acrosin
Orthology
K01317  
acrosin [EC:3.4.21.10]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.10  acrosin
     606765 (ACR)
Peptidases [BR:cfa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   606765 (ACR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 333 aa AA seqDB search
MVEMLPTAVLLVLVVSVVAKDNATCDGPCGLRFRHSTQGASRIIGGQDTVIGAWPWMVSL
QVFTSHNNRRYHACGGTLLNSHWLLTAAHCFVSKKKVYDWRLIFGAREIVYGNDKPAKPP
QQERYVEKIIIHESYVPSLEYNDIALMKITPPVPCGQFIGPGCLPQFRAGPPRVPQGCWV
AGWGFLKEKAYRIAPTLQEARVNLIDLDLCNSTQWYNGRIRSTNVCAGYPEGKIDTCQVI
PPLQSVPGSGTDSPGNSLSFHMLQSLSLVFPFSPCWASHLFLARGSPCWRDRACVQGTLM
GGHGWGGACRIQMMVSCVFSGNFPCSRMYLYII
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggtggagatgctgccaactgccgttctgctggtcttggtggtgtctgtggttgccaaa
gataacgccacgtgtgatggcccctgtgggctgcggttcaggcacagcacgcagggggcc
agccgcatcatcggagggcaggacacggtgatcggggcctggccctggatggtcagcctc
caggtcttcacctcccacaacaaccggaggtaccacgcgtgcggaggcaccttgctgaac
tcccactggctgctcactgccgctcactgcttcgtctccaaaaagaaagtgtacgactgg
agactgatttttggcgcaagggagatcgtgtatggaaatgataagcccgcgaagccgccc
cagcaggaaagatacgtggagaaaatcatcatccacgagagctacgtccccagtctggag
tacaacgacatcgcgctcatgaagatcacgccgcccgttccgtgcgggcagttcattggc
cccggctgcctgccccagttcagggcgggcccacctagggtgccccagggctgctgggtg
gctggctgggggttcttgaaggagaaagcctacaggatcgcacctacactgcaggaggca
cgcgtgaacctcatcgacctcgacttatgtaactccacccagtggtacaatgggcgcatt
cgttcaaccaacgtgtgtgcaggctaccctgaaggcaagatcgacacctgccaggtcatc
cctcctcttcagagcgtcccaggatccggaacagattctcctggcaactctctctccttt
cacatgctccaatccttgtccttagtttttcccttctctccttgttgggcctctcatcta
tttctggcacgtgggtctccttgttggagagacagggcttgtgttcagggaacactgatg
ggaggccatggatggggtggagcctgcagaatccaaatgatggtttcctgtgtattttct
ggaaactttccatgctcacgaatgtatttatatataatctaa

DBGET integrated database retrieval system