KEGG   Canis familiaris (dog): 607032Help
Entry
607032            CDS       T01007                                 

Gene name
HDAC10
Definition
histone deacetylase 10
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
cfa  Canis familiaris (dog)
Pathway
Alcoholism
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    607032 (HDAC10)
  Substance dependence
   05034 Alcoholism
    607032 (HDAC10)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     607032 (HDAC10)
Protein phosphatases and associated proteins [BR:cfa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     607032 (HDAC10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
10
AA seq 668 aa AA seqDB search
MRTALVYHEDMTAARLLWEDPECEIERPERLTAALRRLQQGGLEQRCLQLAPREASEAEL
GLVHSPEYVSLLRGTQALDTQELRALSGQYDAVYFHPSTFHCARLAVGAALQLVDAVLMG
AVHNGLALVRPPGHHSQRAAANGFCVFNNVAIAARHAQQKHGLQRILIVDWDVHHGQGIQ
YIFEDDPSVLYFSWHRYEHGRFWPYLRESDADAVGQGKGRGFTVNLPWNQVGMGNADYLA
AFLHVLLPVAFEFDPELVLVSAGFDSAIGDPEGQMQATPECFGHLTQLLQVLAGGRVCAV
LEGGYHLESLSQSVCMVVRALLGDPVPPLSGPMEPHRSALESIQSVRAAQAPHWTSLQQQ
GSAPTPRPGTCSADGRTSLVLPGGPTFKAAEAQASAVLSSLLGQLHLHPTPPVRTAVALT
VPDAALGLPPAVLHQEGSAPQEETRAWARLHEALAQDTAFTALGKVLHLLKGILDGQVSS
GVATTPAAAAMLDVALRCSLSHRAQRVLCVAVGQLDRPPDLANDGRTLWLDIRGKEAAAL
SPFHVSMPLPGTTGAFLSCVLALVLPLAYGFRPDLVLMVLGPAQGLQEPHAALLAALLRG
PAGGRVLVLVEQEPTSQLAGILARVLHGDAPPSLGPFSTAPPEDTQALLYLRGQLEAQWK
MLQVAAPS
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgaggaccgcgctcgtgtaccatgaggacatgacagccgcgcggctgctctgggaagac
cccgagtgtgagatcgagcgacccgagcgcctgaccgcagccctgcggcgcctgcagcag
gggggcctggagcagaggtgcctccagctggccccccgagaggcctccgaggcggagctg
ggcctggtccacagcccagagtacgtgtccctgttgcgaggaacccaggccttggacacc
caggagctgcgggcgctgtcgggacagtacgatgcagtctacttccacccgagcaccttc
cactgcgcccggctggccgtgggggccgcgctgcagctggtggacgcggtgctgatggga
gccgtgcacaacgggcttgccctggtcagacctcctgggcaccacagccagagggccgct
gccaacggattctgtgtgttcaacaacgtggccatcgcagccaggcacgcgcagcagaaa
cacggcctgcagaggattctcattgtcgactgggatgtccaccacggtcagggcatccag
tatatctttgaggacgaccccagcgttctttacttctcctggcaccgctatgagcatggc
cggttctggccctacctccgggagtcagatgcggacgccgttgggcaggggaagggccgt
ggcttcaccgtcaacctgccctggaaccaggtcgggatgggaaatgctgactacctggcc
gccttcctgcacgtgctgctccccgtggcctttgagtttgatcctgagctggtcctcgtc
tctgcgggatttgactccgcaattggtgaccctgaggggcagatgcaggccacgccagag
tgcttcggccacctcacgcagctgctgcaggtgctggctggaggccgggtctgtgccgtg
ctggagggtggctaccacctggagtccctgtcccagtctgtgtgcatggtggtgagggcg
ctgctgggtgaccctgtcccgcccctgtcggggcccatggagcctcatcgcagtgccctg
gagtccatccagagcgtccgggcagcccaggcccctcactggaccagcctccagcagcaa
gggtcagcccccacaccgaggcccggcacctgctccgcagatgggaggacctcacttgtg
ttgcccgggggacccacgttcaaggcagcggaggcccaggcctcagctgtgctgagttcc
ctcctgggccagctgcacctccaccccacaccccctgtccgcacggctgttgccctgacc
gtgccagatgctgccctgggcctgccccctgctgtcctccatcaggaggggtcagccccc
caggaggagacacgggcctgggccaggctccatgaggccctggcccaggacacagctttc
actgcccttggaaaggtcctgcacctgttgaaggggatcctggatgggcaggtgagcagt
ggtgtcgcaacgacccctgctgcagccgccatgctggatgtggcccttcggtgtagcttg
tcgcacagagcccagagggtgctgtgtgtggctgtgggacagctggaccggcccccagac
cttgccaatgatgggaggactctgtggctggatatcagaggcaaagaagccgctgccctg
tccccgttccacgtctccatgccgctgccagggacaacgggagcattcctgagctgtgtc
ctggccctcgtgctgcccctggcctatggcttccggcctgacctggtgctgatggtgctg
ggaccagcccagggcctgcaggaaccccacgctgcgctcctggctgcactcctgcggggt
ccagcggggggccgagtcctggtcctggtggagcaggaacccacatcccagcttgcaggc
atcctggcccgggtgttgcatggagacgcaccccccagcctgggtcccttctccaccgcc
cccccagaggacacgcaggccctgctgtacttgagagggcagctggaagcacagtggaag
atgctgcaggtggccgctccttcttga

DBGET integrated database retrieval system