KEGG   Canis familiaris (dog): 607040Help
Entry
607040            CDS       T01007                                 

Gene name
HIBCH
Definition
3-hydroxyisobutyryl-CoA hydrolase
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
cfa  Canis familiaris (dog)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    607040 (HIBCH)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    607040 (HIBCH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    607040 (HIBCH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    607040 (HIBCH)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     607040 (HIBCH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
37
AA seq 382 aa AA seqDB search
MGLRQVWRFNSFRRTNVILQHLGMSKHTDAAGEVLLERRGCAGVITLNRPKFLNALNLNM
IRHIYPQLKNWEQDPETFLIIIKGAGGKAFCAGGDIRVISEGGKANQKIAQDFFREEYML
NNAIDCCRKPYVALIHGITMGGGVGLSVHGQFRVATEKSLFAMPETAIGLFPDVGGGYFL
PRLQGKLGYFLALTGFRLKGRDVYAAGIATHFVDSEKLDMLEEDLLALKSPSKENIADVL
DAYHTKSKIDQDKSFILEEHMDKINSWFSANTVEQIIENLQQDGSSFALEQLKVINKMSP
TSLKITVRQLMEGSSKTLQEVLTMEYRLSQACVGGHDFHEGVRAVLIDKDQSPKWKPADL
KEVTDEDLNNYFKPLGSNDLKF
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggggctgcggcaggtgtggaggtttaattcattcagaaggactaatgtcatactgcaa
catttgggaatgtctaagcacacagatgcagcaggagaagtactattggaaagaagaggt
tgtgcaggagtgataacactaaacagaccaaagttcctaaatgcactgaatcttaatatg
attaggcacatttacccacagctaaagaattgggagcaagatcctgaaactttcctgatc
attataaaaggagctggtggaaaggctttctgtgctgggggtgatatcagagtgatctcc
gaaggtggaaaggcaaaccagaagatagctcaagatttctttagagaagaatatatgctg
aacaatgccattgattgttgccggaaaccatatgttgcacttattcatggaattacaatg
ggtggaggagttggtctctcagttcatgggcaattccgagtggctaccgaaaaatctctt
tttgcgatgccagaaacagcaataggactattccctgatgtgggtggaggttatttcttg
ccacgacttcaaggaaaacttggttacttccttgccttaacaggattcaggctgaaagga
agagatgtgtatgcagcaggaattgctacacattttgtagattctgaaaagttggacatg
ttggaagaagatctgttagccctaaaatctccttcaaaagaaaatattgcagatgtctta
gatgcttaccatacaaagtccaagattgatcaagacaagtcttttatacttgaggaacac
atggacaaaataaacagttggttctcggccaatactgtggaacagattattgaaaatcta
caacaggatggctcatcctttgccctagaacagttgaaggtaattaataaaatgtctcca
acatccctaaagatcacagtaaggcaactcatggaggggtcttcaaagaccttgcaggaa
gtattaactatggaatatcggctgagtcaagcttgtgtgggaggccatgactttcatgaa
ggtgttagggcagttttaatagataaagaccagagtccaaagtggaaaccagcggatcta
aaagaagttactgatgaagacttgaataattactttaaacctctgggaagtaatgatttg
aaattttaa

DBGET integrated database retrieval system