KEGG   Canis familiaris (dog): 607040Help
Entry
607040            CDS       T01007                                 

Gene name
HIBCH
Definition
3-hydroxyisobutyryl-CoA hydrolase
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
cfa  Canis familiaris (dog)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:cfa01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cfa00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:cfa00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:cfa00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
37
AA seq 382 aa AA seqDB search
MGLRQVWRFNSFRRTNVILQHLGMSKHTDAAGEVLLERRGCAGVITLNRPKFLNALNLNM
IRHIYPQLKNWEQDPETFLIIIKGAGGKAFCAGGDIRVISEGGKANQKIAQDFFREEYML
NNAIDCCRKPYVALIHGITMGGGVGLSVHGQFRVATEKSLFAMPETAIGLFPDVGGGYFL
PRLQGKLGYFLALTGFRLKGRDVYAAGIATHFVDSEKLDMLEEDLLALKSPSKENIADVL
DAYHTKSKIDQDKSFILEEHMDKINSWFSANTVEQIIENLQQDGSSFALEQLKVINKMSP
TSLKITVRQLMEGSSKTLQEVLTMEYRLSQACVGGHDFHEGVRAVLIDKDQSPKWKPADL
KEVTDEDLNNYFKPLGSNDLKF
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggggctgcggcaggtgtggaggtttaattcattcagaaggactaatgtcatactgcaa
catttgggaatgtctaagcacacagatgcagcaggagaagtactattggaaagaagaggt
tgtgcaggagtgataacactaaacagaccaaagttcctaaatgcactgaatcttaatatg
attaggcacatttacccacagctaaagaattgggagcaagatcctgaaactttcctgatc
attataaaaggagctggtggaaaggctttctgtgctgggggtgatatcagagtgatctcc
gaaggtggaaaggcaaaccagaagatagctcaagatttctttagagaagaatatatgctg
aacaatgccattgattgttgccggaaaccatatgttgcacttattcatggaattacaatg
ggtggaggagttggtctctcagttcatgggcaattccgagtggctaccgaaaaatctctt
tttgcgatgccagaaacagcaataggactattccctgatgtgggtggaggttatttcttg
ccacgacttcaaggaaaacttggttacttccttgccttaacaggattcaggctgaaagga
agagatgtgtatgcagcaggaattgctacacattttgtagattctgaaaagttggacatg
ttggaagaagatctgttagccctaaaatctccttcaaaagaaaatattgcagatgtctta
gatgcttaccatacaaagtccaagattgatcaagacaagtcttttatacttgaggaacac
atggacaaaataaacagttggttctcggccaatactgtggaacagattattgaaaatcta
caacaggatggctcatcctttgccctagaacagttgaaggtaattaataaaatgtctcca
acatccctaaagatcacagtaaggcaactcatggaggggtcttcaaagaccttgcaggaa
gtattaactatggaatatcggctgagtcaagcttgtgtgggaggccatgactttcatgaa
ggtgttagggcagttttaatagataaagaccagagtccaaagtggaaaccagcggatcta
aaagaagttactgatgaagacttgaataattactttaaacctctgggaagtaatgatttg
aaattttaa

DBGET integrated database retrieval system