KEGG   Canis familiaris (dog): 607397Help
Entry
607397            CDS       T01007                                 

Gene name
PFN1
Definition
(RefSeq) profilin 1
  KO
K05759  
profilin
Organism
cfa  Canis familiaris (dog)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    607397 (PFN1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    607397 (PFN1)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    607397 (PFN1)
Cytoskeleton proteins [BR:cfa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     607397 (PFN1)
Exosome [BR:cfa04147]
 Exosomal proteins
  Proteins found in most exosomes
   607397 (PFN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
5
AA seq 147 aa AA seqDB search
MVSPCLSSLLGVCRFPHVCTKQTAYTPCGARCRAGGNRGILTLTAAAFPLQPAEVGVLVG
KDRSSFFVNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSSGGAPTFNITVTMTAKTLVLL
MGKEGVHGGMINKKCYEMASHLRRSQY
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggtctccccgtgtctcagcagtctcttaggagtttgtcggtttccacacgtgtgcaca
aagcagacggcatacaccccatgtggggcgcggtgcagggcagggggaaaccgggggatc
ctgaccctgacggccgctgccttccccttgcagccagctgaggtcggtgtcctggttggc
aaagaccggtcgagttttttcgtgaacgggctgacactgggaggccagaagtgttctgtg
atccgggactcgctgctgcaggatggggagtttactatggaccttcgtaccaagagcagc
ggtggagcgcccactttcaacatcactgtcaccatgactgccaagacgctagtcctgctg
atgggcaaagaaggtgtccacggtggtatgatcaacaagaaatgttatgaaatggcttcc
cacctgcggcgttcccagtactga

DBGET integrated database retrieval system