KEGG   Canis familiaris (dog): 607567Help
Entry
607567            CDS       T01007                                 

Definition
arachidonate 12-lipoxygenase, epidermal-type-like
Orthology
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
cfa  Canis familiaris (dog)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:cfa00590]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:cfa04726]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:cfa04750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 647 aa AA seqDB search
MGKYTIRVVTGDSLLAGSCNQVQLWLVGEHWEADLGQKLRPMRRGVSAQRSAPLHLGRLP
LVKLRKDEHLGDFDWFCKWISVRGPGTNGEALFPCYCWVQGSGIVCLPEGTAGPVSDDQS
LFKTHREQEIQKRKRMYRWGSWKDGLILPVAGRTPWDLPKNERFQEDKDFDFSFSLAKAL
EGLVLKGTXNPVKRPEDFKRIFPSAKTALAEKVXNSWKDDALFGYQFLSGANPMLLXRSS
SLPAWLVLPPGMEDLKTQLEKELQAGSLFEADFXLLDGVKLNVIILKQQYVAAPLVMLKL
QPDGKLLPMVIQLQPPHHGCPTPMLPSNPPMAWLLAKTWVRSSDFQMHQLQSHLLRGHLM
AEVISVATMRTLPSLHPIYKLLIPHFRHTMEINIPAWSNLVSRWGIFDLGVSTSSGGHVD
ILQRATACLTYHSLCPLADLADRGLLDVKASLXGQDALRLWGIISRYVEGMVGLFYMTDE
AVRDDPELQAWCREITETGLQGARDRGFPVSLDTRVQLCHFVTMCIFMCPGQHASAHLGQ
LDWYSWIPNGPCTMRKPPPVSKDVTEKDIVDSLPTAHQAHMQKTFTKFLGRRQPIMVALG
QHKERYFSGPRPQAVAAVDQEIEARNAGLQLPYEYLRPSMVENSVTI
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagtacacgatccgcgtggtcaccggggactcgctcctggcgggttcctgcaac
caggtgcagctgtggctggtcggcgagcactgggaggccgacctggggcagaagctgagg
cccatgcgccgcggggtcagtgcgcagcggtccgcccccctccacctgggccgcctcccg
ctggtgaagcttcgcaaggacgaacacttgggggacttcgactggttctgcaagtggatc
tccgtgcgcggccccgggaccaacggcgaggccctattcccctgctattgctgggtgcag
ggctctgggatcgtctgtctgcccgagggcaccgccggacccgtgagcgacgaccagagc
ctgtttaagacgcaccgagagcaggaaatccagaaaagaaagaggatgtaccggtggggc
tcctggaaagatgggttaatactgcctgtagcagggagaacaccgtgggacctccccaag
aatgagagattccaggaggataaggattttgacttctctttctcgctggcaaaagcgttg
gagggcttggtcctcaaggggacancaaatccagttaaaagaccggaagatttcaaaaga
atattcccaagtgcgaagactgcgctggctgagaaggtttgaaattcctggaaggatgat
gccctcttcgggtaccagttcctcagtggtgcaaaccccatgctcctgnngcgctcgagc
agcctcccagcctggctggtgctgcctccagggatggaagacttgaagacccagttggag
aaagaactccaggctggatctctatttgaagctgatttcntcctgctagatggggtcaag
cttaatgtaatcattttaaaacaacaatatgtggccgcccctctggttatgctgaagctg
cagcctgatgggaagctcttacccatggtcatccagctgcagcctcctcatcacggctgc
cccacacccatgctgccctccaacccccctatggcctggctgctggccaagacctgggtc
cgtagctctgacttccagatgcaccagctacagtcacatctcctgcggggacacctgatg
gctgaggttatttctgtggccacgatgaggaccctgcccagcctgcatcccatctacaag
cttctgatcccacacttccgccacaccatggagatcaacatccccgcctggagcaatctt
gtctccagatggggaatttttgacctgggggtgagcaccagtagcggaggccatgtggac
attctccagagagccacagcttgcttgacctatcattccctctgccctctggccgacctg
gctgaccgtgggctcttggatgtgaaggcttctctcntaggccaagatgccctcaggctg
tgggggatcatcagccggtacgtggaggggatggtcggtcttttctacatgactgatgaa
gctgtgagggatgatccagagctgcaggcctggtgcagagagatcaccgagacggggttg
cagggtgcccgggaccgggggttccccgtctccttagacacccgggttcagctctgccac
tttgtcaccatgtgtatcttcatgtgcccaggtcagcatgcctctgcccacctgggccag
ctggactggtactcctggatccccaacggcccgtgcaccatgcggaagcccccgcccgtc
tccaaggacgtgacagagaaggatatagtggactcgctgcccacggcccaccaggcccac
atgcagaagaccttcacaaagttccttggcagacgccagcccatcatggtggccctgggg
cagcacaaggagagatatttctcaggccctcggccccaggccgtggctgccgtggaccag
gagatagaggcccgcaatgcaggcctgcagctgccctatgagtaccttcgacccagcatg
gtggagaacagcgtgaccatatga

DBGET integrated database retrieval system