KEGG   Canis familiaris (dog): 607567Help
Entry
607567            CDS       T01007                                 

Definition
(RefSeq) arachidonate 12-lipoxygenase, epidermal-type-like
  KO
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
cfa  Canis familiaris (dog)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Antifolate resistance
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    607567
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    607567
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    607567
 Human Diseases
  Drug resistance
   01523 Antifolate resistance
    607567
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     607567
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
5
AA seq 675 aa AA seqDB search
MGKYTIRVVTGDSLLAGSCNQVQLWLVGEHWEADLGQKLRPMRRGVSAQRAGPSSKSAPL
HLGRLPLVKLRKDEHLGDFDWFCKWISVRGPGTNGEALFPCYCWVQGSGIVCLPEGTGEH
VRQDRLCRVKGWAPCPLPHPGPVSDDQSLFKTHREQEIQKRKRMYRWGSWKDGLILPVAG
RTPWDLPKNERFQEDKDFDFSFSLAKALEGLVLKGTXNPVKRPEDFKRIFPSAKTALAEK
VXNSWKDDALFGYQFLSGANPMLLXRSSSLPAWLVLPPGMEDLKTQLEKELQAGSLFEAD
FXLLDGVKLNVIILKQQYVAAPLVMLKLQPDGKLLPMVIQLQPPHHGCPTPMLPSNPPMA
WLLAKTWVRSSDFQMHQLQSHLLRGHLMAEVISVATMRTLPSLHPIYKLLIPHFRHTMEI
NIPAWSNLVSRWGIFDLGVSTSSGGHVDILQRATACLTYHSLCPLADLADRGLLDVKASL
XGQDALRLWGIISRYVEGMVGLFYMTDEAVRDDPELQAWCREITETGLQGARDRGFPVSL
DTRVQLCHFVTMCIFMCPGQHASAHLGQLDWYSWIPNGPCTMRKPPPVSKDVTEKDIVDS
LPTAHQAHMQKTFTKFLGRRQPIMVALGQHKERYFSGPRPQAVAAVDQEIEARNAGLQLP
YEYLRPSMVENSVTI
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagtacacgatccgcgtggtcaccggggactcgctcctggcgggttcctgcaac
caggtgcagctgtggctggtcggcgagcactgggaggccgacctggggcagaagctgagg
cccatgcgccgcggggtcagtgcgcagcgggcgggaccgagttcaaagtccgcccccctc
cacctgggccgcctcccgctggtgaagcttcgcaaggacgaacacttgggggacttcgac
tggttctgcaagtggatctccgtgcgcggccccgggaccaacggcgaggccctattcccc
tgctattgctgggtgcagggctctgggatcgtctgtctgcccgagggcaccggggaacac
gtgaggcaggacaggttgtgcagggtgaaagggtgggccccgtgtccccttccccatccc
ggacccgtgagcgacgaccagagcctgtttaagacgcaccgagagcaggaaatccagaaa
agaaagaggatgtaccggtggggctcctggaaagatgggttaatactgcctgtagcaggg
agaacaccgtgggacctccccaagaatgagagattccaggaggataaggattttgacttc
tctttctcgctggcaaaagcgttggagggcttggtcctcaaggggacancaaatccagtt
aaaagaccggaagatttcaaaagaatattcccaagtgcgaagactgcgctggctgagaag
gtttgaaattcctggaaggatgatgccctcttcgggtaccagttcctcagtggtgcaaac
cccatgctcctgnngcgctcgagcagcctcccagcctggctggtgctgcctccagggatg
gaagacttgaagacccagttggagaaagaactccaggctggatctctatttgaagctgat
ttcntcctgctagatggggtcaagcttaatgtaatcattttaaaacaacaatatgtggcc
gcccctctggttatgctgaagctgcagcctgatgggaagctcttacccatggtcatccag
ctgcagcctcctcatcacggctgccccacacccatgctgccctccaacccccctatggcc
tggctgctggccaagacctgggtccgtagctctgacttccagatgcaccagctacagtca
catctcctgcggggacacctgatggctgaggttatttctgtggccacgatgaggaccctg
cccagcctgcatcccatctacaagcttctgatcccacacttccgccacaccatggagatc
aacatccccgcctggagcaatcttgtctccagatggggaatttttgacctgggggtgagc
accagtagcggaggccatgtggacattctccagagagccacagcttgcttgacctatcat
tccctctgccctctggccgacctggctgaccgtgggctcttggatgtgaaggcttctctc
ntaggccaagatgccctcaggctgtgggggatcatcagccggtacgtggaggggatggtc
ggtcttttctacatgactgatgaagctgtgagggatgatccagagctgcaggcctggtgc
agagagatcaccgagacggggttgcagggtgcccgggaccgggggttccccgtctcctta
gacacccgggttcagctctgccactttgtcaccatgtgtatcttcatgtgcccaggtcag
catgcctctgcccacctgggccagctggactggtactcctggatccccaacggcccgtgc
accatgcggaagcccccgcccgtctccaaggacgtgacagagaaggatatagtggactcg
ctgcccacggcccaccaggcccacatgcagaagaccttcacaaagttccttggcagacgc
cagcccatcatggtggccctggggcagcacaaggagagatatttctcaggccctcggccc
caggccgtggctgccgtggaccaggagatagaggcccgcaatgcaggcctgcagctgccc
tatgagtaccttcgacccagcatggtggagaacagcgtgaccatatga

DBGET integrated database retrieval system