KEGG   Canis familiaris (dog): 607567Help
Entry
607567            CDS       T01007                                 

Definition
(RefSeq) arachidonate 12-lipoxygenase, epidermal-type-like
  KO
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
cfa  Canis familiaris (dog)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    607567
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    607567
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    607567
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     607567
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
5
AA seq 675 aa AA seqDB search
MGKYTIRVVTGDSLLAGSCNQVQLWLVGEHWEADLGQKLRPMRRGVSAQRAGPSSKSAPL
HLGRLPLVKLRKDEHLGDFDWFCKWISVRGPGTNGEALFPCYCWVQGSGIVCLPEGTGEH
VRQDRLCRVKGWAPCPLPHPGPVSDDQSLFKTHREQEIQKRKRMYRWGSWKDGLILPVAG
RTPWDLPKNERFQEDKDFDFSFSLAKALEGLVLKGTXNPVKRPEDFKRIFPSAKTALAEK
VXNSWKDDALFGYQFLSGANPMLLXRSSSLPAWLVLPPGMEDLKTQLEKELQAGSLFEAD
FXLLDGVKLNVIILKQQYVAAPLVMLKLQPDGKLLPMVIQLQPPHHGCPTPMLPSNPPMA
WLLAKTWVRSSDFQMHQLQSHLLRGHLMAEVISVATMRTLPSLHPIYKLLIPHFRHTMEI
NIPAWSNLVSRWGIFDLGVSTSSGGHVDILQRATACLTYHSLCPLADLADRGLLDVKASL
XGQDALRLWGIISRYVEGMVGLFYMTDEAVRDDPELQAWCREITETGLQGARDRGFPVSL
DTRVQLCHFVTMCIFMCPGQHASAHLGQLDWYSWIPNGPCTMRKPPPVSKDVTEKDIVDS
LPTAHQAHMQKTFTKFLGRRQPIMVALGQHKERYFSGPRPQAVAAVDQEIEARNAGLQLP
YEYLRPSMVENSVTI
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagtacacgatccgcgtggtcaccggggactcgctcctggcgggttcctgcaac
caggtgcagctgtggctggtcggcgagcactgggaggccgacctggggcagaagctgagg
cccatgcgccgcggggtcagtgcgcagcgggcgggaccgagttcaaagtccgcccccctc
cacctgggccgcctcccgctggtgaagcttcgcaaggacgaacacttgggggacttcgac
tggttctgcaagtggatctccgtgcgcggccccgggaccaacggcgaggccctattcccc
tgctattgctgggtgcagggctctgggatcgtctgtctgcccgagggcaccggggaacac
gtgaggcaggacaggttgtgcagggtgaaagggtgggccccgtgtccccttccccatccc
ggacccgtgagcgacgaccagagcctgtttaagacgcaccgagagcaggaaatccagaaa
agaaagaggatgtaccggtggggctcctggaaagatgggttaatactgcctgtagcaggg
agaacaccgtgggacctccccaagaatgagagattccaggaggataaggattttgacttc
tctttctcgctggcaaaagcgttggagggcttggtcctcaaggggacancaaatccagtt
aaaagaccggaagatttcaaaagaatattcccaagtgcgaagactgcgctggctgagaag
gtttgaaattcctggaaggatgatgccctcttcgggtaccagttcctcagtggtgcaaac
cccatgctcctgnngcgctcgagcagcctcccagcctggctggtgctgcctccagggatg
gaagacttgaagacccagttggagaaagaactccaggctggatctctatttgaagctgat
ttcntcctgctagatggggtcaagcttaatgtaatcattttaaaacaacaatatgtggcc
gcccctctggttatgctgaagctgcagcctgatgggaagctcttacccatggtcatccag
ctgcagcctcctcatcacggctgccccacacccatgctgccctccaacccccctatggcc
tggctgctggccaagacctgggtccgtagctctgacttccagatgcaccagctacagtca
catctcctgcggggacacctgatggctgaggttatttctgtggccacgatgaggaccctg
cccagcctgcatcccatctacaagcttctgatcccacacttccgccacaccatggagatc
aacatccccgcctggagcaatcttgtctccagatggggaatttttgacctgggggtgagc
accagtagcggaggccatgtggacattctccagagagccacagcttgcttgacctatcat
tccctctgccctctggccgacctggctgaccgtgggctcttggatgtgaaggcttctctc
ntaggccaagatgccctcaggctgtgggggatcatcagccggtacgtggaggggatggtc
ggtcttttctacatgactgatgaagctgtgagggatgatccagagctgcaggcctggtgc
agagagatcaccgagacggggttgcagggtgcccgggaccgggggttccccgtctcctta
gacacccgggttcagctctgccactttgtcaccatgtgtatcttcatgtgcccaggtcag
catgcctctgcccacctgggccagctggactggtactcctggatccccaacggcccgtgc
accatgcggaagcccccgcccgtctccaaggacgtgacagagaaggatatagtggactcg
ctgcccacggcccaccaggcccacatgcagaagaccttcacaaagttccttggcagacgc
cagcccatcatggtggccctggggcagcacaaggagagatatttctcaggccctcggccc
caggccgtggctgccgtggaccaggagatagaggcccgcaatgcaggcctgcagctgccc
tatgagtaccttcgacccagcatggtggagaacagcgtgaccatatga

DBGET integrated database retrieval system