KEGG   Canis familiaris (dog): 607616Help
Entry
607616            CDS       T01007                                 

Gene name
ANGPT2, ANG-2
Definition
angiopoietin 2
Orthology
K05466  
angiopoietin 2
Organism
cfa  Canis familiaris (dog)
Pathway
Ras signaling pathway
Rap1 signaling pathway
HIF-1 signaling pathway
PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    607616 (ANGPT2)
   04015 Rap1 signaling pathway
    607616 (ANGPT2)
   04066 HIF-1 signaling pathway
    607616 (ANGPT2)
   04151 PI3K-Akt signaling pathway
    607616 (ANGPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
16
AA seq 495 aa AA seqDB search
MWQIVFFTLSCDLVRAAAYNNFRRSMDSIGRRQYQVQHGSCSYTFLLPETDNCRSPGSYV
PNAVQRDAPLDYDDSVQRLQVLENIMENNTQWLIKLENYIQDNMKKEMVEMQQNAVQNQT
AVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEI
NKLQDKNSFLEKKVLDMEDKHIVQLRSIKEEKDQLQVLVSKQNSIIEELEKQLVTATVNN
SVLQKQQHDLMETVHSLLTMISPSKSPKDTFVAKEEQIIYRDCAEVFKSGLTTNGIYTLT
FPNSTEEIKAYCDMETSGGGWTVIQRREDGSVDFQRTWKEYKVGFGNPSGEHWLGNEFVF
QVTNQQPYVLKIHLKDWEGNEAYSLYEHFYLSGEELNYRIHLKGLTGTAGKISSISQPGN
DFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSG
YSLKGTTMMIRPADF
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagattgttttctttactctgagctgtgatcttgtccgagccgcagcctacaac
aattttcggagaagcatggacagcatcgggagaaggcagtatcaggttcagcacgggtcc
tgcagctacacgttcctcctgccagaaacagacaactgccgctcccccggctcctacgtg
cccaacgccgtgcagagggacgcgcctctagattacgacgactcggtgcagcggctccaa
gtgttagagaacatcatggagaataatacgcagtggctaattaagcttgagaattacata
caggacaacatgaagaaagagatggtagagatgcaacagaatgcagtacagaaccagact
gccgtgatgatagaaattggaacaaacctactaaatcaaacagcagagcaaacacggaag
ttaacagatgtcgaagcacaagtattaaatcagacaacaagacttgaacttcagcttctg
gaacattccctttccaccaacaaattggaaaaacagattttggatcagaccagtgaaata
aacaaattgcaagataagaacagtttcctggaaaagaaagtactagacatggaagacaag
catatagttcaactacggtcaataaaagaagagaaagatcagctccaggtgttagtatcc
aagcaaaactccatcattgaagaactagaaaaacagttagtgaccgccacagtgaataat
tcggttctccagaagcagcaacatgatctgatggagacagttcatagtttattgactatg
atatcaccatcaaaatcacctaaggacacctttgttgctaaggaagagcagatcatttac
agagactgtgcagaagtattcaagtcaggactgacaaccaatggcatctatacgctaaca
ttccctaattccacagaggagataaaggcatactgcgacatggaaacctctggaggtggg
tggacggtcattcagcggcgtgaagatggcagtgttgattttcagaggacttggaaagaa
tataaagtgggatttgggaacccttctggcgaacactggctgggaaatgagtttgttttc
caagtgaccaatcaacagccatatgtgcttaaaatacaccttaaggactgggagggaaac
gaggcgtactcgctgtatgaacatttctatctctccggtgaagaactcaattacaggatt
caccttaaaggacttacagggacggccggcaaaataagcagcataagccaaccaggaaat
gattttagcacaaaggatgcagacaacgacaaatgtatttgcaaatgttcacaaatgctc
acaggaggctggtggtttgatgcatgcggcccctccaacttgaacggaatgtactacccg
cagaggcagaacacaaataagttcaacggcattaagtggtactactggaaaggctcaggc
tactcgctcaagggcacaaccatgatgatccgaccggcggacttctag

DBGET integrated database retrieval system