KEGG   Canis familiaris (dog): 608039Help
Entry
608039            CDS       T01007                                 

Gene name
POMT1
Definition
protein-O-mannosyltransferase 1
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
cfa  Canis familiaris (dog)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    608039 (POMT1)
Enzymes [BR:cfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     608039 (POMT1)
Glycosyltransferases [BR:cfa01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   608039 (POMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 741 aa AA seqDB search
MLGFLKRPVVVTADINLNVVALTAVGLLSRLWHLAYPRAVVRDDCWQYYGAVPLWLTFDE
VYYGQYISFYMKRIFFLDGSGPPFGHMLLALGGYLGGFDGNFLWNRIGAEYSSNVPVWSL
RLLPALTGAFSIPMAYQILLELGFSHCAAMGAALLMLIENALITQSRLMLLESVLIFFNL
LAVLSYLKFSNSQKHRPFSLSWWFWLMLTGVACSCAVGVKYMGIFTYLLVLAVASVHAWH
LIGDQTLSNVCVLCHLLARAAALLVIPTLMYLLFFYVHLILVYRSGPHDQIMSSAFQASL
EGGLARITQGQPLEVAYGSQVTLKNVFGKPVPCWLHSHQSTYPMIYENGRGSSHQQQVTC
YPFKDVNNWWIVKDPGRHQLVVNNPPRPVRHGDVVQLVHGMTTRFLNTHDVAAPLSPHSQ
EVSCYVDYNISMPSQNLWRLDIVNRESDTEVWKTILSEVRLVHVNTSAVLKLSGAHLPDW
GFQQLEVVGEKLSRGYHESMVWNVEEHRYGKSQEQKERELELHSPAQMDVSRNLSFMARF
LELQWRMLTAKSDDSEHKYSSSPLDWVTLDTSIAYWLHPRTSAQIHLLGNIVIWASASLA
MVVYVLLFFWYLLRRRRSICDIPEDSWLRWVLAGALCAGGWAVNYLPFFMMEKTLFLYHY
LPALTFQILLLPVVLQHVSDHLCRSQLLRSLFSALVVAWYSCACHVFNTLRPLTYGDKSL
SPSELKALRWKDSWDILIRKH
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgttgggatttttgaagcgccccgtggtggtgacagctgacatcaacttgaacgttgtg
gctctgactgcagtgggattactgagccgcctgtggcatctcgcctatccgagggctgtg
gtgagagatgactgctggcagtactacggggccgttcccttgtggctaacttttgatgaa
gtgtattatgggcagtacatctctttttacatgaagcggatcttctttttggatggcagt
ggaccaccgtttggccacatgctgctggccttaggaggttatttaggaggattcgatggt
aactttttgtggaacaggatcggagcagaatacagcagcaacgtgcccgtgtggtctttg
cgcctgctgccagccctcactggggcgttctcgatccccatggcctaccagatcctgttg
gagctcggtttttctcactgcgctgccatgggggctgctctgctgatgcttattgagaac
gctctcatcacgcagtcaaggctcatgcttttggagtcagtgttaatattttttaatcta
ctggctgtgctatcctacctgaagttctccaactcccaaaaacacaggcccttctccttg
agctggtggttttggctgatgctgacaggagtggcctgctcctgtgcggtgggcgtcaag
tacatgggtattttcacatacctgctcgtgctcgcagttgctagtgtccatgcctggcac
ctgatcggagaccagactctgtcaaatgtctgtgtgctctgtcacctgcttgcccgagcc
gccgctctgcttgtcatccccaccctcatgtacttgctgttcttctacgtccacttgatc
ctggtctaccgctctgggccccacgatcaaatcatgtccagtgctttccaggccagtctg
gagggaggactagcccggatcacgcagggtcagcccctggaggtggcctacggttcccag
gtcactctgaagaatgtctttggcaaacctgtgccctgctggcttcattcccaccagagc
acctaccccatgatatacgagaacggccgaggcagctcgcaccagcagcaggtgacttgt
taccccttcaaagacgtcaacaactggtggatcgtgaaggatcccgggaggcaccagctg
gtggtgaacaaccccccgaggcccgtgcggcacggggacgtggtgcagctggtgcacggt
atgaccacccgcttcctcaacacgcacgacgtggcggcgcccctgagcccccactcgcag
gaggtgtcctgctacgttgattacaacatctccatgccctcccagaacctctggagactg
gacattgtaaaccgagaatccgacacagaggtttggaagaccatcttgtccgaggtccgc
ctggtgcacgtgaacacctctgccgtcctaaagctgagcggggcacacctcccagactgg
gggttccagcagctggaggtcgttggggagaagctgtcccggggctaccacgagagcatg
gtgtggaatgtggaagaacatcgatatggcaaaagccaggagcaaaaggagagggagctg
gagctgcactcaccggcacagatggacgtcagcagaaacctaagcttcatggccaggttc
ctggagctgcagtggaggatgcttacggcaaagagtgatgactcggagcacaagtacagc
tcctcgccgctggactgggtcaccctggacaccagcatcgcctactggctgcaccccagg
accagcgctcagatccacctgcttggaaacattgtgatctgggcttcggccagcctcgcc
atggtggtctacgtcctgctcttcttctggtacctgctcagacgccgaaggagtatctgc
gacatccctgaggattcctggctgcgctgggtgctggccggggctctgtgtgccggcggc
tgggcagtgaactacctccccttcttcatgatggagaagacgctcttcctctaccactac
cttcccgcgctcaccttccagatcctcctgctccctgtggtcttgcagcacgtcagcgac
cacctgtgcaggtcccagctcctgaggagcctcttcagcgccctggttgtggcctggtac
tcctgtgcctgtcacgtgttcaacacgctgcgcccactgacctacggagacaagtcactc
tcacccagtgaactcaaggcccttcgctggaaagacagctgggacatcttgatccggaaa
cactag

DBGET integrated database retrieval system