KEGG   Canis familiaris (dog): 608188Help
Entry
608188            CDS       T01007                                 

Gene name
USP2
Definition
(RefSeq) ubiquitin specific peptidase 2
  KO
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.4.19.12]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     608188 (USP2)
Peptidases [BR:cfa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   608188 (USP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 395 aa AA seqDB search
MRPSFAVALPEEPAAAPFPALPRDLGPSCCLAPSLCLQPHLPCVLCLQNSKSAQGLAGLR
NLGNTCFMNSILQCLSNTRELRDYCLQRLYMRDLSHSSNVHTALMEEFAKLIQTIWTSSP
NDVVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVTVRPKSNPENLDHL
PDDEKGRQMWRKYLEREDSRIGDLFVGQLKSSLTCTDCGYCSTVFDPFWDLSLPIAKRGY
PEVTLTDCMRLFTKEDVLDGDEKPTCCRCRARKRCIKKFSIQRFPKILVLHLKRFSESRI
RTSKLTTFVNFPLRDLDLREFASENTNHAVYNLYAVSNHSGTTMGGHYTAYCRSPVTGEW
HTFNDSSVTPMSSSQVRTSDAYLLFYELASPPSRM
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccctccttcgccgtggccctgcccgaggagcccgcagccgccccctttcccgcc
ctcccaagagacctgggacccagctgctgtcttgctccatctctttgccttcagcctcac
ctgccatgtgttctttgcttacagaattctaagagcgcccagggtctggctggtcttcga
aaccttgggaacacgtgcttcatgaactccattctgcagtgcctgagcaacacccgggag
ctgagggattactgcctccagaggctctatatgcgggatctcagccacagcagcaatgta
cacacagccctcatggaagagtttgcaaaactaatccaaaccatatggacttcatccccc
aacgatgtggtgagcccatctgagttcaagacccagatccagagatacgcaccacgcttc
gtcggctataatcagcaagacgcccaggagtttcttcgcttccttctggatgggctccac
aatgaggtgaaccgagtgacagtgaggcccaagtccaaccccgagaacctcgatcatctt
cctgatgatgagaaaggacgacagatgtggaggaaatatctagaacgggaagacagtcgg
attggggatctcttcgttgggcagctaaagagctccctgacttgtactgactgtggttac
tgctctactgtctttgatcccttctgggacctctcattgcccatcgctaagcgaggttat
cccgaggtaactttaacggactgcatgaggctcttcaccaaagaggatgtgcttgatggt
gatgaaaagccaacatgctgtcgctgccgagccagaaaacgatgtataaagaagttctcc
atccagaggttcccaaagatcttggtgctccatctgaagcggttctcagaatccagaata
cgaaccagcaagctcacaacatttgtgaatttcccactaagagacctggacctgagagaa
tttgcctcagaaaacaccaaccacgctgtttacaacctgtacgctgtgtccaatcactct
ggaaccaccatgggcggccattacacagcctactgccggagtccagtgacaggcgaatgg
cacactttcaatgactccagcgtcacacccatgtcctccagccaagtgcgcaccagcgac
gcctacctgctcttctatgaactggccagtccaccctcccgcatgtag

DBGET integrated database retrieval system