KEGG   Canis familiaris (dog): 608188Help
Entry
608188            CDS       T01007                                 

Gene name
USP2
Definition
ubiquitin specific peptidase 2
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
cfa  Canis familiaris (dog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 395 aa AA seqDB search
MRPSFAVALPEEPAAAPFPALPRDLGPSCCLAPSLCLQPHLPCVLCLQNSKSAQGLAGLR
NLGNTCFMNSILQCLSNTRELRDYCLQRLYMRDLSHSSNVHTALMEEFAKLIQTIWTSSP
NDVVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVTVRPKSNPENLDHL
PDDEKGRQMWRKYLEREDSRIGDLFVGQLKSSLTCTDCGYCSTVFDPFWDLSLPIAKRGY
PEVTLTDCMRLFTKEDVLDGDEKPTCCRCRARKRCIKKFSIQRFPKILVLHLKRFSESRI
RTSKLTTFVNFPLRDLDLREFASENTNHAVYNLYAVSNHSGTTMGGHYTAYCRSPVTGEW
HTFNDSSVTPMSSSQVRTSDAYLLFYELASPPSRM
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccctccttcgccgtggccctgcccgaggagcccgcagccgccccctttcccgcc
ctcccaagagacctgggacccagctgctgtcttgctccatctctttgccttcagcctcac
ctgccatgtgttctttgcttacagaattctaagagcgcccagggtctggctggtcttcga
aaccttgggaacacgtgcttcatgaactccattctgcagtgcctgagcaacacccgggag
ctgagggattactgcctccagaggctctatatgcgggatctcagccacagcagcaatgta
cacacagccctcatggaagagtttgcaaaactaatccaaaccatatggacttcatccccc
aacgatgtggtgagcccatctgagttcaagacccagatccagagatacgcaccacgcttc
gtcggctataatcagcaagacgcccaggagtttcttcgcttccttctggatgggctccac
aatgaggtgaaccgagtgacagtgaggcccaagtccaaccccgagaacctcgatcatctt
cctgatgatgagaaaggacgacagatgtggaggaaatatctagaacgggaagacagtcgg
attggggatctcttcgttgggcagctaaagagctccctgacttgtactgactgtggttac
tgctctactgtctttgatcccttctgggacctctcattgcccatcgctaagcgaggttat
cccgaggtaactttaacggactgcatgaggctcttcaccaaagaggatgtgcttgatggt
gatgaaaagccaacatgctgtcgctgccgagccagaaaacgatgtataaagaagttctcc
atccagaggttcccaaagatcttggtgctccatctgaagcggttctcagaatccagaata
cgaaccagcaagctcacaacatttgtgaatttcccactaagagacctggacctgagagaa
tttgcctcagaaaacaccaaccacgctgtttacaacctgtacgctgtgtccaatcactct
ggaaccaccatgggcggccattacacagcctactgccggagtccagtgacaggcgaatgg
cacactttcaatgactccagcgtcacacccatgtcctccagccaagtgcgcaccagcgac
gcctacctgctcttctatgaactggccagtccaccctcccgcatgtag

DBGET integrated database retrieval system