KEGG   Canis familiaris (dog): 608378Help
Entry
608378            CDS       T01007                                 

Gene name
RPTOR
Definition
(RefSeq) regulatory associated protein of MTOR, complex 1
  KO
K07204  
regulatory associated protein of mTOR
Organism
cfa  Canis familiaris (dog)
Pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Longevity regulating pathway - multiple species
Insulin signaling pathway
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    608378 (RPTOR)
   04152 AMPK signaling pathway
    608378 (RPTOR)
   04150 mTOR signaling pathway
    608378 (RPTOR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    608378 (RPTOR)
  Aging
   04211 Longevity regulating pathway - mammal
    608378 (RPTOR)
   04213 Longevity regulating pathway - multiple species
    608378 (RPTOR)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    608378 (RPTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 1315 aa AA seqDB search
MEAEMLQAPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSV
ALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYK
QSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSIY
DLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNC
IQLAACEANELLPMIPDLPADLFTSCLTTPIKIALRWIPGRLNDRRTPLGELNWIFTAIT
DTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMWQ
AWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWLTMGVENRNPPEQLPIVLQVL
LSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILA
VDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILAVIVNSYNTGQEACLQGNLIA
ICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSAHEKLCSLLSDPIPEVRCAAV
FALGTFVGNSAERTDHSTTIDHNVAMMLAQLINDGSPVVRKELVVALSHLVVQYESNFCT
VALQFMEEEKNYPLPSPAATEGGSLTPVRDSPCTPRLRSVSSYGNIRAVTTARSLNKSLQ
NLSLTEESGSSVAFSPGNLSTSSSASSTLGSPENEEYILSFETIDKMRRVSSYSALNSLI
GVSFNSVYTQIWRVLLHLAADPYPDVSDLAMKVLNSIAYKATVNARPQRILTTSSLTQSA
PASPTNKGIHIHQAGGSPPTSSASSSSLTNDVAKQPVSRDLPAGRPGAPGPAGVQYTPHS
QQFPRTRKMFDKGPDQTTDDADDAAGHRSFVSATTQTGFCDWSARYFAQPVMKIPEEHDL
ESQIRKEREWRFLRNTRVRQQARQLIQKGIAKLDDQIFLNRNPGVPSVVKFHPFTPCVAV
ADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQDCSLLLTATDDGAIRVWKNFA
DLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMSSGDVRIVRIWDTDREMKVQD
IPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALSECRVMTYREHTAWVVKAYLQ
KHPEGHIMSVSVNGDVRFFDPRMPESVNVLQIVKGLTALDIHPQANLIACGSMNQFTAIY
SGNGELINHIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEKRAR
NT seq 3948 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgagatgctgcaggcgcccctcctggggctcggggaggaggacgaggccgac
ctcaccgactggaacctgcccttggccttcatgaaaaagcggcactgtgagaagatcgaa
ggctccaagtccttagcccagagctggaggatgaaggatcggatgaagacggtcagtgtt
gccttagttttgtgcctgaatgtcggcgtggaccctccagatgtggtgaagaccaccccc
tgtgcacgtttggagtgctggatcgatcctctgtcgatggggcctcagaaagctctggaa
accatcggtgcgaatttgcagaagcagtacgagaactggcagccaagggcccggtacaag
cagagccttgaccccactgtggacgaagtgaagaagctttgtacatccttacgccgaaat
gccaaggaggagcgggttctcttccactacaacggccacggggtgcccaggccaaccgtg
aacggggagatctgggtcttcaacaagaactacactcagtacatccctctgtctatatat
gacctgcagacgtggatgggcagcccatcaatcttcgtctacgactgctccaatgccggc
ttgatcgtcaagtccttcaaacagttcgccctgcagagggagcaggagcttgaggtcgct
gccattaacccaaaccacccactcgcgcagatgcccctgcctccgtccatgaagaactgc
attcagctggcggcctgtgaggccaacgagctcctgcccatgatccccgacctcccggcc
gacctgttcacgtcgtgcctcaccacccccatcaaaattgccctgcgctggattcctggc
cggctgaacgaccgcaggacccccctgggagaactgaactggatcttcacagcaatcaca
gacaccatcgcgtggaatgtgctccctcgggatctcttccaaaagctcttcagacaggac
ctgttggtggctagtctgtttcgaaattttctcctggcggaaaggatcatgaggtcttac
aactgcacccccgtcagcagcccacgcctgcctcccacttacatgcacgcgatgtggcaa
gcctgggaccttgccgtcgacatttgcctctctcagctgcccaccatcatcgaggaaggc
actgcatttcggcacagtccgttctttgccgagcagctgaccgcgttccaggtgtggctc
acgatgggcgtggagaacaggaacccacccgagcaacttcccattgtcctgcaggtgctg
ctgagccaggtgcacaggctgagagccctggatttgctgggacgattcttggacctgggc
ccctgggccgtgagcttggccttgtctgtgggcatcttcccctacgtgctgaaactgctc
cagagctcagccagagagctgcggccccttctggttttcatctgggccaagatcctcgct
gtggacagttcatgccaagctgacctggtgaaggacaacggtcacaaatacttcctgtcc
gtcttggccgacccttacatgccagccgagcaccggaccatgacggctttcatcctcgct
gtgatcgtcaacagctacaacacggggcaggaggcctgcctccagggaaacctgatcgcc
atctgcctggagcaactcaacgacccgcacccgctcctgcgccagtgggtggccatctgt
ctgggccgcatctggcagaactttgactcggccaggtggtgtggcgtgagggacagcgcg
cacgagaagctctgcagcctcctctctgaccccatccctgaggtgcgctgcgcggcggtc
ttcgcccttggtacctttgtgggcaactccgcagagaggaccgaccactcgaccaccatc
gaccacaacgtggccatgatgctggcccagctgatcaacgacgggagccccgtggtccgc
aaggaactggtggtggctctgagtcatcttgtcgttcagtacgaaagcaatttctgcacc
gtggccttgcagttcatggaggaggagaagaactaccccttgccttctccagcggccaca
gagggcgggagcctgaccccagtgcgggacagcccgtgcacccccagactccgctccgtg
agttcctatggaaacattcgtgccgtcaccactgcccgaagcttgaacaagtctttgcag
aatctgagcttgacggaagaatctggcagctccgtggcattctcccccgggaacctcagc
accagcagcagcgccagcagcaccctgggcagccccgagaacgaggagtacatcctgtcc
ttcgagaccatcgacaagatgcgtcgcgtcagctcctactcggccctcaactccctcatc
ggagtctcctttaacagtgtttacacgcagatttggagagtcttactgcatctggctgcg
gatccctatccagacgtttccgacttggccatgaaggtgctcaacagcattgcttacaag
gccacagtgaatgcccggccccagcgcatcctcaccacgtcctcactcacccagtcggcg
cccgccagccccaccaacaagggcatccacatccaccaggcggggggctccccgccaaca
tccagcgccagcagctccagcctgaccaacgatgtggccaagcagccagtcagccgagac
ctgcccgcgggccgtcctggtgcccctggccccgctggggtgcagtacacgccccactct
cagcagttcccccgcacgcggaagatgtttgacaagggcccagaccagaccaccgacgat
gcagatgatgccgctggacacagaagctttgtctcggccacaacacagactggcttctgt
gactggagcgcccggtacttcgcccagcctgtcatgaagatcccagaagaacacgacctg
gagagtcagatccgcaaggaacgagagtggcgatttctccgcaacacacgcgtccgacag
caggcgcgccagctcatccagaagggtatcgcaaaactggacgaccagatatttctgaac
aggaaccccggcgtcccctccgtggtcaagttccacccctttacaccatgtgtggccgtg
gctgataaagacagcatctgtttctgggactgggagaagggggagaagctggattacttc
cacaacgggaacccccggtacaccagggtcaccgccatggagtacctcaacggccaggac
tgctcgctgctgctcacggccacggatgatggcgccatccgggtctggaagaacttcgca
gatttggagaagaacccagagatggtgacggcttggcagggactctcggacatgctgccg
acaaccagaggagctgggatggtggtggactgggagcaggagaccggcctcctcatgagc
tcgggggacgtgcggatcgtccggatctgggacacggaccgtgagatgaaggtgcaggac
atccccacaggcgccgacagctgcgtgaccagcctgtcctgtgactcccaccgctccctc
atcgtggccggcctcggcgatggctccatccgtgtctacgaccgaaggatggcgctcagt
gaatgccgcgtcatgacgtaccgggagcacacggcctgggtggtgaaggcctacctccag
aagcaccccgagggccacatcatgagcgtgagtgtcaacggggacgtgcgtttcttcgac
cctcggatgccagagtctgtgaacgtccttcagatcgtgaaggggctcacggccctcgac
atccacccccaggcaaacctgatcgcctgcggctccatgaatcagttcacggccatctac
agcgggaacggggagctcatcaaccacatcaagtactacgacgggttcatgggccagcgc
gtcggggccatcagctgcctggccttccacccgcactggcctcacctggccgtgggcagc
aacgactactacatctccgtgtactccgtggagaagcgtgccagatag

DBGET integrated database retrieval system