KEGG   Canis familiaris (dog): 608378Help
Entry
608378            CDS       T01007                                 

Gene name
RPTOR
Definition
regulatory associated protein of MTOR, complex 1
Orthology
K07204  
regulatory associated protein of mTOR
Organism
cfa  Canis familiaris (dog)
Pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
MicroRNAs in cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:cfa04151]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:cfa04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:cfa04910]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:cfa05206]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 1177 aa AA seqDB search
MEAEMLQAPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSV
ALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYK
QSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSIY
DLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNC
IQLAACEANELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPG
RLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSY
NCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWL
TMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLL
QSSARELRPLLVFIWAKILAVDSELVVALSHLVVQYESNFCTVALQFMEEEKNYPLPSPA
ATEGGSLTPVRDSPCTPRLRSVSSYGNIRAVTTARSLNKSLQNLSLTEESGSSVAFSPGN
LSTSSSASSTLGSPENEEYILSFETIDKMRRVSSYSALNSLIGVSFNSVYTQIWRVLLHL
AADPYPDVSDLAMKVLNSIAYKATVNARPQRILTTSSLTQSAPASPTNKGIHIHQAGGSP
PTSSASSSSLTNDVAKQPVSRDLPAGRPGAPGPAGVQYTPHSQQFPRTRKMFDKGPDQTT
DDADDAAGHRSFVSATTQTGFCDWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNTRV
RQQARQLIQKGIAKLDDQIFLNRNPGVPSVVKFHPFTPCVAVADKDSICFWDWEKGEKLD
YFHNGNPRYTRVTAMEYLNGQDCSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDM
LPTTRGAGMVVDWEQETGLLMSSGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDSHR
SLIVAGLGDGSIRVYDRRMALSECRVMTYREHTAWVVKAYLQKHPEGHIMSVSVNGDVRF
FDPRMPESVNVLQIVKGLTALDIHPQANLIACGSMNQFTAIYSGNGELINHIKYYDGFMG
QRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEKRAR
NT seq 3534 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgagatgctgcaggcgcccctcctggggctcggggaggaggacgaggccgac
ctcaccgactggaacctgcccttggccttcatgaaaaagcggcactgtgagaagatcgaa
ggctccaagtccttagcccagagctggaggatgaaggatcggatgaagacggtcagtgtt
gccttagttttgtgcctgaatgtcggcgtggaccctccagatgtggtgaagaccaccccc
tgtgcacgtttggagtgctggatcgatcctctgtcgatggggcctcagaaagctctggaa
accatcggtgcgaatttgcagaagcagtacgagaactggcagccaagggcccggtacaag
cagagccttgaccccactgtggacgaagtgaagaagctttgtacatccttacgccgaaat
gccaaggaggagcgggttctcttccactacaacggccacggggtgcccaggccaaccgtg
aacggggagatctgggtcttcaacaagaactacactcagtacatccctctgtctatatat
gacctgcagacgtggatgggcagcccatcaatcttcgtctacgactgctccaatgccggc
ttgatcgtcaagtccttcaaacagttcgccctgcagagggagcaggagcttgaggtcgct
gccattaacccaaaccacccactcgcgcagatgcccctgcctccgtccatgaagaactgc
attcagctggcggcctgtgaggccaacgagctcctgcccatgatccccgacctcccggcc
gacctgttcacgtcgtgcctcaccacccccatcaaaattgccctgcgctggttctgcatg
cagaaatgcgttagtctggtgcctggggtcacactggatttgatagaaaagattcctggc
cggctgaacgaccgcaggacccccctgggagaactgaactggatcttcacagcaatcaca
gacaccatcgcgtggaatgtgctccctcgggatctcttccaaaagctcttcagacaggac
ctgttggtggctagtctgtttcgaaattttctcctggcggaaaggatcatgaggtcttac
aactgcacccccgtcagcagcccacgcctgcctcccacttacatgcacgcgatgtggcaa
gcctgggaccttgccgtcgacatttgcctctctcagctgcccaccatcatcgaggaaggc
actgcatttcggcacagtccgttctttgccgagcagctgaccgcgttccaggtgtggctc
acgatgggcgtggagaacaggaacccacccgagcaacttcccattgtcctgcaggtgctg
ctgagccaggtgcacaggctgagagccctggatttgctgggacgattcttggacctgggc
ccctgggccgtgagcttggccttgtctgtgggcatcttcccctacgtgctgaaactgctc
cagagctcagccagagagctgcggccccttctggttttcatctgggccaagatcctcgct
gtggacagtgaactggtggtggctctgagtcatcttgtcgttcagtacgaaagcaatttc
tgcaccgtggccttgcagttcatggaggaggagaagaactaccccttgccttctccagcg
gccacagagggcgggagcctgaccccagtgcgggacagcccgtgcacccccagactccgc
tccgtgagttcctatggaaacattcgtgccgtcaccactgcccgaagcttgaacaagtct
ttgcagaatctgagcttgacggaagaatctggcagctccgtggcattctcccccgggaac
ctcagcaccagcagcagcgccagcagcaccctgggcagccccgagaacgaggagtacatc
ctgtccttcgagaccatcgacaagatgcgtcgcgtcagctcctactcggccctcaactcc
ctcatcggagtctcctttaacagtgtttacacgcagatttggagagtcttactgcatctg
gctgcggatccctatccagacgtttccgacttggccatgaaggtgctcaacagcattgct
tacaaggccacagtgaatgcccggccccagcgcatcctcaccacgtcctcactcacccag
tcggcgcccgccagccccaccaacaagggcatccacatccaccaggcggggggctccccg
ccaacatccagcgccagcagctccagcctgaccaacgatgtggccaagcagccagtcagc
cgagacctgcccgcgggccgtcctggtgcccctggccccgctggggtgcagtacacgccc
cactctcagcagttcccccgcacgcggaagatgtttgacaagggcccagaccagaccacc
gacgatgcagatgatgccgctggacacagaagctttgtctcggccacaacacagactggc
ttctgtgactggagcgcccggtacttcgcccagcctgtcatgaagatcccagaagaacac
gacctggagagtcagatccgcaaggaacgagagtggcgatttctccgcaacacacgcgtc
cgacagcaggcgcgccagctcatccagaagggtatcgcaaaactggacgaccagatattt
ctgaacaggaaccccggcgtcccctccgtggtcaagttccacccctttacaccatgtgtg
gccgtggctgataaagacagcatctgtttctgggactgggagaagggggagaagctggat
tacttccacaacgggaacccccggtacaccagggtcaccgccatggagtacctcaacggc
caggactgctcgctgctgctcacggccacggatgatggcgccatccgggtctggaagaac
ttcgcagatttggagaagaacccagagatggtgacggcttggcagggactctcggacatg
ctgccgacaaccagaggagctgggatggtggtggactgggagcaggagaccggcctcctc
atgagctcgggggacgtgcggatcgtccggatctgggacacggaccgtgagatgaaggtg
caggacatccccacaggcgccgacagctgcgtgaccagcctgtcctgtgactcccaccgc
tccctcatcgtggccggcctcggcgatggctccatccgtgtctacgaccgaaggatggcg
ctcagtgaatgccgcgtcatgacgtaccgggagcacacggcctgggtggtgaaggcctac
ctccagaagcaccccgagggccacatcatgagcgtgagtgtcaacggggacgtgcgtttc
ttcgaccctcggatgccagagtctgtgaacgtccttcagatcgtgaaggggctcacggcc
ctcgacatccacccccaggcaaacctgatcgcctgcggctccatgaatcagttcacggcc
atctacagcgggaacggggagctcatcaaccacatcaagtactacgacgggttcatgggc
cagcgcgtcggggccatcagctgcctggccttccacccgcactggcctcacctggccgtg
ggcagcaacgactactacatctccgtgtactccgtggagaagcgtgccagatag

DBGET integrated database retrieval system