KEGG   Canis familiaris (dog): 608378Help
Entry
608378            CDS       T01007                                 

Gene name
RPTOR
Definition
(RefSeq) regulatory associated protein of MTOR complex 1
  KO
K07204  regulatory associated protein of mTOR
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04136  Autophagy - other
cfa04140  Autophagy - animal
cfa04150  mTOR signaling pathway
cfa04151  PI3K-Akt signaling pathway
cfa04152  AMPK signaling pathway
cfa04211  Longevity regulating pathway
cfa04213  Longevity regulating pathway - multiple species
cfa04714  Thermogenesis
cfa04910  Insulin signaling pathway
cfa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    608378 (RPTOR)
   04152 AMPK signaling pathway
    608378 (RPTOR)
   04150 mTOR signaling pathway
    608378 (RPTOR)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    608378 (RPTOR)
   04136 Autophagy - other eukaryotes
    608378 (RPTOR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    608378 (RPTOR)
  Aging
   04211 Longevity regulating pathway - mammal
    608378 (RPTOR)
   04213 Longevity regulating pathway - multiple species
    608378 (RPTOR)
  Environmental adaptation
   04714 Thermogenesis
    608378 (RPTOR)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    608378 (RPTOR)
Membrane trafficking [BR:cfa04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    608378 (RPTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Raptor_N HEAT HEAT_2 WD40 Cnd1 HEAT_EZ Hyccin
Motif
Other DBs
NCBI-GeneID: 608378
NCBI-ProteinID: XP_005624073
Ensembl: ENSCAFG00000005692
Position
9
AA seq 1315 aa AA seqDB search
MEAEMLQAPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSV
ALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYK
QSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSIY
DLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNC
IQLAACEANELLPMIPDLPADLFTSCLTTPIKIALRWIPGRLNDRRTPLGELNWIFTAIT
DTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMWQ
AWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWLTMGVENRNPPEQLPIVLQVL
LSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILA
VDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILAVIVNSYNTGQEACLQGNLIA
ICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSAHEKLCSLLSDPIPEVRCAAV
FALGTFVGNSAERTDHSTTIDHNVAMMLAQLINDGSPVVRKELVVALSHLVVQYESNFCT
VALQFMEEEKNYPLPSPAATEGGSLTPVRDSPCTPRLRSVSSYGNIRAVTTARSLNKSLQ
NLSLTEESGSSVAFSPGNLSTSSSASSTLGSPENEEYILSFETIDKMRRVSSYSALNSLI
GVSFNSVYTQIWRVLLHLAADPYPDVSDLAMKVLNSIAYKATVNARPQRILTTSSLTQSA
PASPTNKGIHIHQAGGSPPTSSASSSSLTNDVAKQPVSRDLPAGRPGAPGPAGVQYTPHS
QQFPRTRKMFDKGPDQTTDDADDAAGHRSFVSATTQTGFCDWSARYFAQPVMKIPEEHDL
ESQIRKEREWRFLRNTRVRQQARQLIQKGIAKLDDQIFLNRNPGVPSVVKFHPFTPCVAV
ADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQDCSLLLTATDDGAIRVWKNFA
DLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMSSGDVRIVRIWDTDREMKVQD
IPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALSECRVMTYREHTAWVVKAYLQ
KHPEGHIMSVSVNGDVRFFDPRMPESVNVLQIVKGLTALDIHPQANLIACGSMNQFTAIY
SGNGELINHIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEKRAR
NT seq 3948 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgagatgctgcaggcgcccctcctggggctcggggaggaggacgaggccgac
ctcaccgactggaacctgcccttggccttcatgaaaaagcggcactgtgagaagatcgaa
ggctccaagtccttagcccagagctggaggatgaaggatcggatgaagacggtcagtgtt
gccttagttttgtgcctgaatgtcggcgtggaccctccagatgtggtgaagaccaccccc
tgtgcacgtttggagtgctggatcgatcctctgtcgatggggcctcagaaagctctggaa
accatcggtgcgaatttgcagaagcagtacgagaactggcagccaagggcccggtacaag
cagagccttgaccccactgtggacgaagtgaagaagctttgtacatccttacgccgaaat
gccaaggaggagcgggttctcttccactacaacggccacggggtgcccaggccaaccgtg
aacggggagatctgggtcttcaacaagaactacactcagtacatccctctgtctatatat
gacctgcagacgtggatgggcagcccatcaatcttcgtctacgactgctccaatgccggc
ttgatcgtcaagtccttcaaacagttcgccctgcagagggagcaggagcttgaggtcgct
gccattaacccaaaccacccactcgcgcagatgcccctgcctccgtccatgaagaactgc
attcagctggcggcctgtgaggccaacgagctcctgcccatgatccccgacctcccggcc
gacctgttcacgtcgtgcctcaccacccccatcaaaattgccctgcgctggattcctggc
cggctgaacgaccgcaggacccccctgggagaactgaactggatcttcacagcaatcaca
gacaccatcgcgtggaatgtgctccctcgggatctcttccaaaagctcttcagacaggac
ctgttggtggctagtctgtttcgaaattttctcctggcggaaaggatcatgaggtcttac
aactgcacccccgtcagcagcccacgcctgcctcccacttacatgcacgcgatgtggcaa
gcctgggaccttgccgtcgacatttgcctctctcagctgcccaccatcatcgaggaaggc
actgcatttcggcacagtccgttctttgccgagcagctgaccgcgttccaggtgtggctc
acgatgggcgtggagaacaggaacccacccgagcaacttcccattgtcctgcaggtgctg
ctgagccaggtgcacaggctgagagccctggatttgctgggacgattcttggacctgggc
ccctgggccgtgagcttggccttgtctgtgggcatcttcccctacgtgctgaaactgctc
cagagctcagccagagagctgcggccccttctggttttcatctgggccaagatcctcgct
gtggacagttcatgccaagctgacctggtgaaggacaacggtcacaaatacttcctgtcc
gtcttggccgacccttacatgccagccgagcaccggaccatgacggctttcatcctcgct
gtgatcgtcaacagctacaacacggggcaggaggcctgcctccagggaaacctgatcgcc
atctgcctggagcaactcaacgacccgcacccgctcctgcgccagtgggtggccatctgt
ctgggccgcatctggcagaactttgactcggccaggtggtgtggcgtgagggacagcgcg
cacgagaagctctgcagcctcctctctgaccccatccctgaggtgcgctgcgcggcggtc
ttcgcccttggtacctttgtgggcaactccgcagagaggaccgaccactcgaccaccatc
gaccacaacgtggccatgatgctggcccagctgatcaacgacgggagccccgtggtccgc
aaggaactggtggtggctctgagtcatcttgtcgttcagtacgaaagcaatttctgcacc
gtggccttgcagttcatggaggaggagaagaactaccccttgccttctccagcggccaca
gagggcgggagcctgaccccagtgcgggacagcccgtgcacccccagactccgctccgtg
agttcctatggaaacattcgtgccgtcaccactgcccgaagcttgaacaagtctttgcag
aatctgagcttgacggaagaatctggcagctccgtggcattctcccccgggaacctcagc
accagcagcagcgccagcagcaccctgggcagccccgagaacgaggagtacatcctgtcc
ttcgagaccatcgacaagatgcgtcgcgtcagctcctactcggccctcaactccctcatc
ggagtctcctttaacagtgtttacacgcagatttggagagtcttactgcatctggctgcg
gatccctatccagacgtttccgacttggccatgaaggtgctcaacagcattgcttacaag
gccacagtgaatgcccggccccagcgcatcctcaccacgtcctcactcacccagtcggcg
cccgccagccccaccaacaagggcatccacatccaccaggcggggggctccccgccaaca
tccagcgccagcagctccagcctgaccaacgatgtggccaagcagccagtcagccgagac
ctgcccgcgggccgtcctggtgcccctggccccgctggggtgcagtacacgccccactct
cagcagttcccccgcacgcggaagatgtttgacaagggcccagaccagaccaccgacgat
gcagatgatgccgctggacacagaagctttgtctcggccacaacacagactggcttctgt
gactggagcgcccggtacttcgcccagcctgtcatgaagatcccagaagaacacgacctg
gagagtcagatccgcaaggaacgagagtggcgatttctccgcaacacacgcgtccgacag
caggcgcgccagctcatccagaagggtatcgcaaaactggacgaccagatatttctgaac
aggaaccccggcgtcccctccgtggtcaagttccacccctttacaccatgtgtggccgtg
gctgataaagacagcatctgtttctgggactgggagaagggggagaagctggattacttc
cacaacgggaacccccggtacaccagggtcaccgccatggagtacctcaacggccaggac
tgctcgctgctgctcacggccacggatgatggcgccatccgggtctggaagaacttcgca
gatttggagaagaacccagagatggtgacggcttggcagggactctcggacatgctgccg
acaaccagaggagctgggatggtggtggactgggagcaggagaccggcctcctcatgagc
tcgggggacgtgcggatcgtccggatctgggacacggaccgtgagatgaaggtgcaggac
atccccacaggcgccgacagctgcgtgaccagcctgtcctgtgactcccaccgctccctc
atcgtggccggcctcggcgatggctccatccgtgtctacgaccgaaggatggcgctcagt
gaatgccgcgtcatgacgtaccgggagcacacggcctgggtggtgaaggcctacctccag
aagcaccccgagggccacatcatgagcgtgagtgtcaacggggacgtgcgtttcttcgac
cctcggatgccagagtctgtgaacgtccttcagatcgtgaaggggctcacggccctcgac
atccacccccaggcaaacctgatcgcctgcggctccatgaatcagttcacggccatctac
agcgggaacggggagctcatcaaccacatcaagtactacgacgggttcatgggccagcgc
gtcggggccatcagctgcctggccttccacccgcactggcctcacctggccgtgggcagc
aacgactactacatctccgtgtactccgtggagaagcgtgccagatag

DBGET integrated database retrieval system