KEGG   Canis familiaris (dog): 608452Help
Entry
608452            CDS       T01007                                 

Gene name
CYP4B1
Definition
cytochrome P450, family 4, subfamily B, polypeptide 1
Orthology
K07426  
cytochrome P450, family 4, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
cfa  Canis familiaris (dog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15
AA seq 511 aa AA seqDB search
MVSTLLSLSVSHLVLWATGLILVLGFLKLIRLLLRRQMLARAMDSFPGPPTHWLFGHAQE
IQQTGSLDKVVTWAHQYDYAHPLWLGPFLGFLNIYEPDYAKAVYSRGDPKAADVYDFFLQ
WIGKGLLVLQGPKWYQHRKLLTPGFHYDVLKSYVAVFTNSTHAMLDKWEEKAREDKSFDI
FCDVGYMALDSLMKCTFGKGDSSLGHRDSSYYSAVRDLTLLMQQRIESFQYHNDFIYWLT
PHGRRFLRACQAAHDHTDQVIRERKAALQDEKEQEKIQNRRHLDFLDILLGARDENGIKL
SDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPQHQHRCREEVCEILGDRDSFQWDDL
VKMTYLTMCIKESFRLYPPVPQVYRQLSKPVNFVDGRSLPAGSLISLHIYALHRNSAVWP
DPEVFDPLRFSSENVARRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTALCLLRFEFALDP
LQLPVKMPQLILRSKNGIHLHLKSLRLGSGK
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggtttctaccttgctctccttgagtgtctcccatctggtcttgtgggctactggattg
atcttggtcttaggcttcctcaagctcatccgtctgctgttgcggagacagatgctggcc
agggctatggacagtttcccagggccccccacccactggctcttcggacatgcccaggag
atccagcagacggggagcctggacaaggtggtgacctgggcccaccagtacgattatgcc
cacccactctggcttggaccgttccttggcttcctgaacatctatgagccggactatgcc
aaagctgtgtacagccgaggggatccgaaggctgcagatgtgtatgacttctttctgcag
tggattgggaaaggcctcctggtcctccaggggcccaagtggtatcagcaccgcaagctg
cttacacctggcttccactatgatgtgctgaaatcctatgtggctgtgttcaccaactcc
acgcacgctatgctggacaagtgggaggaaaaggctcgtgaagataagagctttgacatc
ttctgtgacgtgggctacatggcactggactccctcatgaagtgcacctttggcaaagga
gacagcagtctgggccacagggacagtagctactactcggctgtccgcgatctcactctg
ctgatgcagcagcgcatcgagtccttccagtaccataacgacttcatctactggctcacc
ccacacggccgccgcttcctgcgggcctgccaggcagcccacgaccacacagaccaggtc
atcagggaacgaaaggcagccctgcaggatgagaaagagcaggagaagatccagaaccgg
aggcacctggacttcttggacattctcctgggggctcgggatgaaaatgggatcaagttg
tcagacgcagacctccgggctgaggtagacacattcatgtttgaaggccatgacaccacc
accagtggcatttcctggtttctctactgcatggctctctacccccagcaccagcatcgt
tgtcgggaggaggtctgcgaaatccttggggaccgggattccttccagtgggatgatctg
gtgaagatgacctacttgaccatgtgcatcaaggaaagcttccgcctctacccacccgtg
ccccaggtataccgccagctcagcaagcctgtcaactttgtggatggccgatccctacct
gcaggcagcctgatctctctgcacatctatgccctccataggaacagtgcagtgtggcct
gaccctgaggtctttgaccctctgcgtttttcctctgagaatgtggccagacgccacccc
tttgccttcatgcccttctctgctgggcccaggaactgcattgggcagcagtttgccatg
aatgagatgaaggtggtcacagctctctgcttgctccgctttgagttcgccctggacccc
ctgcagcttcccgtcaagatgccccagctgatcctgcgctccaagaatggcatccacctc
cacctgaagtcgctacgtctgggctctgggaagtag

DBGET integrated database retrieval system