KEGG   Canis familiaris (dog): 608525Help
Entry
608525            CDS       T01007                                 

Gene name
BPNT1
Definition
3'(2'), 5'-bisphosphate nucleotidase 1
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cfa  Canis familiaris (dog)
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:cfa00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
38
AA seq 379 aa AA seqDB search
MRSSCGRFVLHPPPCDLQPGRRPGAGHREDLLPHSLPLLAFRCLSSSFVPGLSLLIMASS
HTVLMRLVASAYSIAQKAGTIVRRVIAEGDLGIVQKTCATDLQTKADRLAQMSICSSLAR
KFPKLTIIGEEDLPFEEVDQELIEDGQWEEILQQPCPSQYSAIKEEDLVVWVDPLDGTKE
YTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYQNNEKQKLREHRNEAKAGPDAVLGRTI
WGVLGLGAFGFQLKEVPAGKHIITTTRSHNSKLVTDCVTAMNPDDVLRVGGAGNKIIQLI
EGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNALQYNKEVKHMNSAGVLATLR
NYDYYASRVPESVKNALVP
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagtagctgcggtaggtttgtcctccatccaccgccgtgcgacctgcagccggga
aggcggccaggtgctggacaccgcgaggacctgttgcctcatagccttccgttgttagcc
ttcaggtgtctttcgtctagctttgttccaggcttatcactgcttatcatggcttccagt
cacactgtgttgatgcggctggttgcctcagcatattctattgctcagaaggcaggaacc
atagtcagacgtgttattgctgaaggagatctgggtatcgtgcagaagacctgtgcaaca
gacctgcagaccaaagccgaccgattggcacaaatgagcatatgctcttcactggcacgg
aaattccccaaactaacaattataggggaagaggatctgccttttgaagaagtggatcag
gagctcatcgaagatggtcagtgggaggagatactgcagcagccatgcccatcccagtac
agtgctattaaagaagaagaccttgtggtctgggttgatcctctggatggtaccaaggaa
tatactgaaggtcttcttgacaatgtgacagttcttattggaattgcttatgagggaaaa
gccatagcaggagttattaaccagccatattacaactaccagaacaatgaaaagcagaag
ttaagggaacacaggaatgaagccaaggcaggaccagatgctgtgttggggaggacaatc
tggggagttttaggtttgggtgcctttggatttcagctgaaagaggtgcctgctgggaaa
cacatcatcacaacgacccggtcccataatagcaagttggtgactgactgtgtcactgcc
atgaaccctgatgatgtactgcgagtgggaggagcaggaaataagattattcagctgatt
gaaggcaaagcctctgcctatgtatttgcaagtcctggatgtaagaaatgggatacttgt
gctccagaagttattttacatgctgtgggaggcaagttaactgatatccatggaaatgcc
cttcagtacaacaaggaggtgaagcacatgaactctgcaggcgtcctggccacgctgcgc
aactacgactactatgcaagccgagttccagaatctgttaaaaatgcactcgttccttaa

DBGET integrated database retrieval system