KEGG   Canis familiaris (dog): 608657Help
Entry
608657            CDS       T01007                                 

Gene name
TESK2
Definition
testis-specific kinase 2
Orthology
K08842  
testis-specific kinase 2 [EC:2.7.12.1]
Organism
cfa  Canis familiaris (dog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15
AA seq 573 aa AA seqDB search
MDRSKRNSIAGFPPRVERLEDFEGGGGGDGNMTQVGRVRPSSYRALISAFSRLTRLDDFT
CEKIGSGFFSEVFKVRHRASGQVMALKMNTLSSNRANMLKEVQLMNRLSHPNILRFMGVC
VHQGQLHALTEYINSGNLEQLLDSNLHLPWTVRVKLAYDIAVGLSYLHFKGIFHRDLTSK
NCLIKRDENGYSAVVADFGLAEKIPDVSMGNEKLAVVGSPFWMAPEVLRDEPYNEKADVF
SYGIILCEIIARIQADPDYLPRTENFGLDYDAFQHMVGDCPPDFLQLTFNCCNMDPKLRP
TFAEIGKTLEEILSHLQEEELQTDRKLQPTAKGLLEKGPGVKRLSTLDDKIPPKSPRPRR
TIWLSRSQSDIFSRKPLRTVNVLDPYYRPQQGGAAHTPKVNPFSARQDLKGGKIKFFDLP
SKSVISLVFDLDAPGPGTLPVADWQEPLAPPARGWRSLPGSPEFLHQEACPFVGREESLS
DGPPPRLNSLKYRVREIPPFRASALPTALAHEAMDCSSPQEENGFGPRPRGASPCLAGTS
EEMEVEEERPRGLAPVPFCVSGMGLKTQGEHDG
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggatcggagcaaacggaattcaattgcaggctttcctccacgtgtggagcgtcttgaa
gattttgaaggaggtggtggaggagatgggaacatgacccaagtgggaagagttcggcca
tcttcatatcgagctcttataagtgccttttctagactgactcgtttagatgacttcacc
tgtgaaaaaatagggtctggcttcttctctgaagtgttcaaggtgcgccaccgagcttct
ggccaggtgatggctcttaagatgaacactttgagcagtaaccgggcaaacatgctgaaa
gaagttcagctcatgaacagactgtcccatcccaacatcctcaggttcatgggtgtgtgt
gtacatcaaggacagttgcatgcactcacagagtatatcaactctggaaatctggaacag
ttgctagacagtaacctgcatttgccgtggactgtgagggtgaaactggcttatgatata
gcagtgggtctcagctaccttcacttcaaaggcattttccatcgggacctcacatctaag
aactgcctgataaagagggatgagaatggttactctgcagtggtagctgactttggcctg
gctgagaagattcctgacgtcagcatggggaatgagaaactggccgtggtgggctcaccc
ttttggatggcacctgaggttctccgagatgagccctacaatgaaaaggccgacgtgttc
tcttatggtatcatcctctgtgagatcatcgcccgcatccaggctgatccagactatctt
ccccgcacagagaacttcgggctagactatgacgctttccagcatatggtgggagactgt
cccccggactttctgcagctcaccttcaactgctgtaatatggaccccaaactgcgccca
accttcgcggagattgggaagaccctggaggaaattctgagccatctacaggaagaagag
ctgcagacagacaggaagctgcagcccacagctaagggactcttggagaaaggacctggg
gtgaagcgactgagcacactggatgacaaaatacctcccaagtctccacgcccaagacgt
actatctggttatcccgaagccagtctgacatcttctcccgtaagcccttgcgtacagtg
aatgtcttggacccatactaccggccacaacaaggtggtgctgcccatacccccaaagtc
aaccctttcagtgctcgccaggacctcaagggtggcaagatcaagttctttgacctgccc
agcaagtcggtcatctccctggtatttgacctggacgcaccagggccgggaactctgccc
gtggctgactggcaggagcccctggccccacctgctcgtgggtggcgttctttgcccggt
tcaccagagttcttacatcaagaggcctgtccatttgtgggccgagaagaatcactatct
gatgggcccccaccacgcctcaatagtctcaagtacagagtgagagagatcccaccattc
cgagcatctgccctaccaactgctctagcccatgaagccatggactgctccagtccccag
gaagaaaatggtttcgggcccaggccccggggtgccagtccatgccttgcaggtacctct
gaggaaatggaggtagaagaagaaagaccaagaggcttggctccagtccccttctgtgtc
tcaggcatgggcctgaaaacccagggagaacacgatgggtga

DBGET integrated database retrieval system