KEGG   Canis familiaris (dog): 608760Help
Entry
608760            CDS       T01007                                 

Gene name
UGT2B4
Definition
UDP-glucuronosyltransferase 2B31-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
cfa  Canis familiaris (dog)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    608760 (UGT2B4)
   00053 Ascorbate and aldarate metabolism
    608760 (UGT2B4)
   00500 Starch and sucrose metabolism
    608760 (UGT2B4)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    608760 (UGT2B4)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    608760 (UGT2B4)
   00860 Porphyrin and chlorophyll metabolism
    608760 (UGT2B4)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    608760 (UGT2B4)
   00982 Drug metabolism - cytochrome P450
    608760 (UGT2B4)
   00983 Drug metabolism - other enzymes
    608760 (UGT2B4)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    608760 (UGT2B4)
Enzymes [BR:cfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     608760 (UGT2B4)
Glycosyltransferases [BR:cfa01003]
 Others
  Hydrophobic molecule
   608760 (UGT2B4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
13
AA seq 462 aa AA seqDB search
MAEEGRDFRRSSASPRMSMKWISVLLGLQLSCYFSSGSCGKVLVWPTEYSHWINVKTILD
ELVQRGHEVTVLTSSASILVDPNKLSAIKFEIYSAHLSRGDFEALFIKLLNIWIYDMPKD
SFWTYFSVMQEIFWEFYECAEKLCKDVVLNKKLMTKLQESKFDLVLADTIIPCGRPTTLY
ELMRKADIWLIRTYWDFEYPHPLLPHFDFVGGLHCKPAKSLPTEMEEFVQSSGENGIVVF
SLGSMVNNMPEERANVIASALAQIPQKVLWRFDGKKPDTLGPNTRLYKWIPQNDLLGHPK
TKAFITHGGTNGIYEAIYHGIPMVGIPLFADQADNIVHMKAKGAAIRLDFSTMSSADLLD
ALRTVINDPSYKENAMKLSRIHHDQPIKPLDRAVFWIEYVMRHKGAKHLRPASHDLTWFQ
YHSLDVIGFLLACVATAIFVTTQCCLFCCRKVAKTGKKIKKE
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagaaggcagggatttcagaagaagcagcgcatcccccaggatgtctatgaaa
tggatttcagtgcttctggggctacagctgagctgttactttagctctgggagttgcggg
aaggtgctggtgtggcccacggaatacagccactggatcaatgtaaagacaatcctggat
gaacttgtccagaggggtcatgaagtgactgttctgacatcgtcagcttccattcttgtt
gatccgaacaaattatctgctattaaatttgagatttactctgcacatttatctagaggt
gattttgaggctttgttcataaaactgctcaacatttggatatatgatatgccaaaagat
tcattttggacatatttttcagtaatgcaagaaattttttgggaattttatgaatgtgct
gagaagctctgtaaagatgtagttttgaacaagaaactcatgacaaaactacaagaatca
aaatttgatctcgtccttgcagatactatcataccctgcggaagacccactacactatat
gagttaatgaggaaagctgatatatggctcattcgaacctactgggattttgaatatcct
cacccactcttaccacattttgactttgttggaggcctccactgcaaacctgccaaatcc
ctgcctacggaaatggaagagtttgtccagagctctggagaaaacggtattgtggtgttt
tctctagggtcaatggtcaataacatgccagaggaaagagccaatgtgatcgcatcagcc
cttgcccagattccacaaaaggttctatggagatttgatggcaagaaaccagacacctta
gggccaaatactcggctgtataagtggattccccagaatgaccttcttggtcatccgaaa
accaaagcctttataacccatggtggaaccaacggcatctatgaggcgatctaccacggg
atccccatggtgggcattcccttgtttgccgatcaagctgataacattgttcacatgaaa
gctaagggagcagctatcagactggatttcagcacaatgtctagtgcagacttgctcgat
gcattgaggacggtcattaatgacccttcgtacaaagagaatgctatgaagttatcaaga
attcaccacgatcagcctataaagcccctggaccgggcagtcttctggatcgagtatgtc
atgcgccacaaaggagccaagcacctgcggccagcttcccatgacctcacctggttccag
taccactccttggatgtgattgggtttctgctggcctgtgtggcaactgctatatttgtc
accacacaatgttgtctgttttgttgtcggaaggttgcaaaaactgggaagaagataaaa
aaggagtag

DBGET integrated database retrieval system