KEGG   Canis familiaris (dog): 608760Help
Entry
608760            CDS       T01007                                 

Gene name
UGT2B4
Definition
(RefSeq) UDP-glucuronosyltransferase 2B31
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00040  Pentose and glucuronate interconversions
cfa00053  Ascorbate and aldarate metabolism
cfa00140  Steroid hormone biosynthesis
cfa00830  Retinol metabolism
cfa00860  Porphyrin and chlorophyll metabolism
cfa00980  Metabolism of xenobiotics by cytochrome P450
cfa00982  Drug metabolism - cytochrome P450
cfa00983  Drug metabolism - other enzymes
cfa01100  Metabolic pathways
cfa05204  Chemical carcinogenesis
Module
cfa_M00014  Glucuronate pathway (uronate pathway)
cfa_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    608760 (UGT2B4)
   00053 Ascorbate and aldarate metabolism
    608760 (UGT2B4)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    608760 (UGT2B4)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    608760 (UGT2B4)
   00860 Porphyrin and chlorophyll metabolism
    608760 (UGT2B4)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    608760 (UGT2B4)
   00982 Drug metabolism - cytochrome P450
    608760 (UGT2B4)
   00983 Drug metabolism - other enzymes
    608760 (UGT2B4)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    608760 (UGT2B4)
Enzymes [BR:cfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     608760 (UGT2B4)
Glycosyltransferases [BR:cfa01003]
 Others
  Hydrophobic molecule
   608760 (UGT2B4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 608760
NCBI-ProteinID: XP_850502
Ensembl: ENSCAFG00000029232
Position
13
AA seq 546 aa AA seqDB search
MAEEGRDFRRSSASPRMSMKWISVLLGLQLSCYFSSGSCGKVLVWPTEYSHWINVKTILD
ELVQRGHEVTVLTSSASILVDPNKLSAIKFEIYSAHLSRGDFEALFIKLLNIWIYDMPKD
SFWTYFSVMQEIFWEFYECAEKLCKDVVLNKKLMTKLQESKFDLVLADTIIPCGELLAEL
LKIPLVYSLRFSPGYAFEKHSGGLPLPPSYVPVILSELTDQMTFMERVKNMIYVLYFDFW
FQTINEKSWDQFYSEVLGRPTTLYELMRKADIWLIRTYWDFEYPHPLLPHFDFVGGLHCK
PAKSLPTEMEEFVQSSGENGIVVFSLGSMVNNMPEERANVIASALAQIPQKVLWRFDGKK
PDTLGPNTRLYKWIPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQADNI
VHMKAKGAAIRLDFSTMSSADLLDALRTVINDPSYKENAMKLSRIHHDQPIKPLDRAVFW
IEYVMRHKGAKHLRPASHDLTWFQYHSLDVIGFLLACVATAIFVTTQCCLFCCRKVAKTG
KKIKKE
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagaaggcagggatttcagaagaagcagcgcatcccccaggatgtctatgaaa
tggatttcagtgcttctggggctacagctgagctgttactttagctctgggagttgcggg
aaggtgctggtgtggcccacggaatacagccactggatcaatgtaaagacaatcctggat
gaacttgtccagaggggtcatgaagtgactgttctgacatcgtcagcttccattcttgtt
gatccgaacaaattatctgctattaaatttgagatttactctgcacatttatctagaggt
gattttgaggctttgttcataaaactgctcaacatttggatatatgatatgccaaaagat
tcattttggacatatttttcagtaatgcaagaaattttttgggaattttatgaatgtgct
gagaagctctgtaaagatgtagttttgaacaagaaactcatgacaaaactacaagaatca
aaatttgatctcgtccttgcagatactatcataccctgcggtgagctgctggctgagctc
cttaaaatacctttagtgtacagtctccgtttctctccaggctacgcatttgagaaacac
agtggaggacttcctctccctccatcctacgtacctgttattctgtcagaattaactgat
caaatgacattcatggagagagtaaaaaatatgatatatgtgctttattttgacttttgg
ttccaaacaataaatgagaagagttgggatcagttttacagcgaagtactaggaagaccc
actacactatatgagttaatgaggaaagctgatatatggctcattcgaacctactgggat
tttgaatatcctcacccactcttaccacattttgactttgttggaggcctccactgcaaa
cctgccaaatccctgcctacggaaatggaagagtttgtccagagctctggagaaaacggt
attgtggtgttttctctagggtcaatggtcaataacatgccagaggaaagagccaatgtg
atcgcatcagcccttgcccagattccacaaaaggttctatggagatttgatggcaagaaa
ccagacaccttagggccaaatactcggctgtataagtggattccccagaatgaccttctt
ggtcatccgaaaaccaaagcctttataacccatggtggaaccaacggcatctatgaggcg
atctaccacgggatccccatggtgggcattcccttgtttgccgatcaagctgataacatt
gttcacatgaaagctaagggagcagctatcagactggatttcagcacaatgtctagtgca
gacttgctcgatgcattgaggacggtcattaatgacccttcgtacaaagagaatgctatg
aagttatcaagaattcaccacgatcagcctataaagcccctggaccgggcagtcttctgg
atcgagtatgtcatgcgccacaaaggagccaagcacctgcggccagcttcccatgacctc
acctggttccagtaccactccttggatgtgattgggtttctgctggcctgtgtggcaact
gctatatttgtcaccacacaatgttgtctgttttgttgtcggaaggttgcaaaaactggg
aagaagataaaaaaggagtag

DBGET integrated database retrieval system